Sequence 1: | NP_647853.1 | Gene: | CG1136 / 38479 | FlyBaseID: | FBgn0035490 | Length: | 458 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_572895.1 | Gene: | CG15756 / 32308 | FlyBaseID: | FBgn0030493 | Length: | 298 | Species: | Drosophila melanogaster |
Alignment Length: | 201 | Identity: | 48/201 - (23%) |
---|---|---|---|
Similarity: | 59/201 - (29%) | Gaps: | 62/201 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 249 SVISSTTARP---PSLDMLPPLSAHRRRLRPRPTPAPVAIVSSTPAPISGADLYGYSTPQPFAAP 310
Fly 311 AYQFAPPATSSTTGY-----------------GYY--PPPQSP--------------VDVN--SL 340
Fly 341 EAALLPPLPSSSYRRRLRPRPVQGNHLD-----GLAASEYDGVGVTRNGF----RYVLPKQYHEE 396
Fly 397 ETNPSD 402 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG1136 | NP_647853.1 | None | |||
CG15756 | NP_572895.1 | Chitin_bind_4 | 108..162 | CDD:278791 | 9/53 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR10380 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |