DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1136 and Cpr49Aa

DIOPT Version :9

Sequence 1:NP_647853.1 Gene:CG1136 / 38479 FlyBaseID:FBgn0035490 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_001097285.1 Gene:Cpr49Aa / 246413 FlyBaseID:FBgn0050045 Length:144 Species:Drosophila melanogaster


Alignment Length:124 Identity:29/124 - (23%)
Similarity:47/124 - (37%) Gaps:18/124 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 LPRARDQLLSPLPATPLSPLV----DIHSNGDPVQDLEL-NAINVYDAEADRAFGHGQFGSVI-- 251
            |.:||.|:....|..|: |::    :::.:|......|. |.||..:....:..|....|.|.  
  Fly    15 LAQARPQVRGQAPGEPI-PIIRQEQEVNFDGSYKYLYETGNGINAEEEGYLKNPGTDNAGQVAQG 78

  Fly   252 SSTTARPPSLDMLPPLSAHRRRLRPR----PTPAPVAIVSSTPAPISGADLYGYSTPQP 306
            |.:...|..:.:.....|.....:|:    |||.|:      |..|..|..|..:.|.|
  Fly    79 SFSYTSPEGIPIRITYLADENGFQPQGDHLPTPPPI------PPAIQKALAYLATAPPP 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1136NP_647853.1 None
Cpr49AaNP_001097285.1 Chitin_bind_4 46..101 CDD:278791 10/54 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.