DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rcd5 and AT1G60700

DIOPT Version :9

Sequence 1:NP_647852.1 Gene:Rcd5 / 38478 FlyBaseID:FBgn0263832 Length:578 Species:Drosophila melanogaster
Sequence 2:NP_176269.2 Gene:AT1G60700 / 842364 AraportID:AT1G60700 Length:525 Species:Arabidopsis thaliana


Alignment Length:304 Identity:68/304 - (22%)
Similarity:119/304 - (39%) Gaps:75/304 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 TLQELQQRWYALLYEPAVSRIAVSAIRNLHPELVESVQRKALYSVQEEDLLGTIKSSE------- 336
            ||:..::.|...        .:::|:||| |.:.:|   ....:..:|.|.....:||       
plant   275 TLERPRRPWSVC--------CSIAALRNL-PLMEDS---SGACTSLDEQLYANATTSEDRDAELS 327

  Fly   337 QPKLEQFQELLDKNASVFYCARTAKSLQNHWLLLKQYTLLPDQSVKPIYGTDQQPLSFSDAEDQI 401
            ||....:||.:|....:...|           ::::..|:||.|          ...|:..|..:
plant   328 QPPSTLYQEEVDGEEEIDIDA-----------MIRKLNLVPDDS----------DSCFNREEWNM 371

  Fly   402 FEHDLNEPRDEALEMERALADRRNKRNIRLLENELSRWAVLVDSVLSPTAASEFDNQTLACLCGR 466
            .:|    ||...:.:|:.......:             |::....::          .|.|...:
plant   372 SKH----PRHALIGLEQCTRTSMQR-------------AIMFHGAIA----------VLHCPDSK 409

  Fly   467 HVRYLMRSKEITFGRDAKDCVVDVDLGLEGPAAKISRRQGTIKLRSNGDFFIANEGKRAIFIDGT 531
            |   .:|.:|:..||.:....||:|||.....:||||||..:||.:.|.|.:.|.||:.|.::|.
plant   410 H---FVRKREVIIGRSSGGLNVDIDLGKYNYGSKISRRQALVKLENYGSFSLKNLGKQHILVNGG 471

  Fly   532 PLLSANKARLGHNCTVEISGLRFTFLVNYELI-----NAIRQES 570
            .|.......|....::.|.|:.|.|.:|.|.:     |..|::|
plant   472 KLDRGQIVTLTSCSSINIRGITFVFKINKEAVGQFLKNNTRRKS 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rcd5NP_647852.1 MCRS_N 246..444 CDD:290064 30/171 (18%)
FHA 465..559 CDD:238017 31/93 (33%)
AT1G60700NP_176269.2 FHA 410..500 CDD:238017 31/92 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4206
eggNOG 1 0.900 - - E1_KOG2293
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005081
OrthoInspector 1 1.000 - - otm2640
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13233
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.000

Return to query results.
Submit another query.