DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11593 and NRK1

DIOPT Version :9

Sequence 1:NP_001261392.1 Gene:CG11593 / 38477 FlyBaseID:FBgn0035488 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_014270.1 Gene:NRK1 / 855594 SGDID:S000005073 Length:240 Species:Saccharomyces cerevisiae


Alignment Length:232 Identity:39/232 - (16%)
Similarity:78/232 - (33%) Gaps:78/232 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 LDSISNHSFDDDEDIEHNLASLSPSSSLIDGLDGEDDDDDCEGPELLPDHDDDLELDLEFGLATT 278
            |.::|..|......|....|||...::||.    |||         ...||:::.:|.::.:   
Yeast     8 LVALSGCSSSGKTTIAKLTASLFTKATLIH----EDD---------FYKHDNEVPVDAKYNI--- 56

  Fly   279 PTPNAPASATAASTLPQYTAAEERRDSRNWQKITLPDGRTREIDMRVIEPYKRVLSHGGYLKS-- 341
                                       :||..   |:.    :|.::......|:...|.:.:  
Yeast    57 ---------------------------QNWDS---PEA----LDFKLFGKELDVIKQTGKIATKL 87

  Fly   342 -GGQNAIVIFCACHLP----DRSRADYSYVMDNLFLYVVKTLEQLVTDDYVLIYLHGGSNRRNV- 400
             ...|....|...|:.    |..:|.|..:.|:.:       |.::.|.:::....|.|.:.:: 
Yeast    88 IHNNNVDDPFTKFHIDRQVWDELKAKYDSINDDKY-------EVVIVDGFMIFNNTGISKKFDLK 145

  Fly   401 ----PPFPWLKRCYQLLDRRLRKSLKHMYLVHPTFWI 433
                .|:..||:         |::.:..|....:||:
Yeast   146 ILVRAPYEVLKK---------RRASRKGYQTLDSFWV 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11593NP_001261392.1 BNIP2 <293..342 CDD:289278 6/51 (12%)
CRAL_TRIO_2 345..475 CDD:290435 18/98 (18%)
NRK1NP_014270.1 NRK1 8..198 CDD:238982 39/232 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.