DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11593 and Arhgap8

DIOPT Version :10

Sequence 1:NP_647851.3 Gene:CG11593 / 38477 FlyBaseID:FBgn0035488 Length:484 Species:Drosophila melanogaster
Sequence 2:XP_006521531.1 Gene:Arhgap8 / 73167 MGIID:1920417 Length:480 Species:Mus musculus


Alignment Length:159 Identity:55/159 - (34%)
Similarity:90/159 - (56%) Gaps:9/159 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   328 PYKRVLSHGGYLKSGGQN----AIVIFCACHLPDRSRADYSYVMDNLFLYVVKTLEQLVTDDYVL 388
            |:..|..| |.|:..|.:    .|..|..|.||...:.::..:::    |:..||:|.|.:||.:
Mouse    68 PFYDVARH-GILQVAGDDRQGRRIFTFSCCRLPPLHQLNHQRLLE----YLKYTLDQHVENDYTI 127

  Fly   389 IYLHGGSNRRNVPPFPWLKRCYQLLDRRLRKSLKHMYLVHPTFWIKSLVWMARPFVSTKFWRKLV 453
            :|.|.|.:.:|.|...||:..|:..||:.:|:||.:|:||||..||:|..:.:|.:|.||.:|:.
Mouse   128 VYFHYGLSSQNKPSLGWLQNTYKEFDRKYKKNLKALYVVHPTSLIKALWNIFKPLISHKFGKKVT 192

  Fly   454 YVKSLEELGMHVVVEKAAIPEKVKQYDAK 482
            |..:|.||..|:..::..||.:|.:||.|
Mouse   193 YCSNLRELREHLQCDQLLIPPEVVRYDEK 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11593NP_647851.3 BNIP2 <293..342 CDD:463609 5/13 (38%)
CRAL_TRIO_2 345..475 CDD:463965 45/133 (34%)
Arhgap8XP_006521531.1 CRAL_TRIO_2 87..220 CDD:463965 47/136 (35%)
RhoGAP 248..436 CDD:470621
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.