DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11593 and Uckl1

DIOPT Version :9

Sequence 1:NP_001261392.1 Gene:CG11593 / 38477 FlyBaseID:FBgn0035488 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_001365934.1 Gene:Uckl1 / 68556 MGIID:1915806 Length:549 Species:Mus musculus


Alignment Length:330 Identity:68/330 - (20%)
Similarity:113/330 - (34%) Gaps:101/330 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KMDISETPTDSTGV----------------SP---LADDVLPTAPEKNILKLEQAKQDHDKEELE 61
            :.||||...|..||                .|   |||.|:|.. ..|.:.::...|        
Mouse   239 RRDISERGRDIEGVIKQYNKFVKPAFDQYIQPTMRLADIVVPRG-SGNTVAIDLIVQ-------- 294

  Fly    62 FKTTSALDNRILRPELLPMEA------MPQRHNIIERT--LANSHPLMSPTNTDSDSEPFQLKKQ 118
             ...|.|:.|.||.::..:.:      :||..::::.|  :...|.::....|..|...|..|:.
Mouse   295 -HVHSQLEERKLRWDMAALASAHQCHPLPQTLSVLKSTPQVRGMHTIIRDKETSRDEFIFYSKRL 358

  Fly   119 -----EKQLPRSNFPDVVPTTETVQVKNNLNQCRNKPQDAKVSLLRAN---SPDILSSESDADVS 175
                 |..|....|.|.  |.:|.|.::.:.:|....|...||:|||.   .|.:.:...|..:.
Mouse   359 MRLLIEHALSFLPFQDC--TVQTPQGQDYVGKCYAGKQITGVSILRAGETMEPALRAVCKDVRIG 421

  Fly   176 QYLAAVESNFQSVSLMPNGNGKKSKRSTALPGGEDIS-------------------SLDSISNHS 221
            ..|  :::|        ...|:.......||  :|||                   ::..:.:|.
Mouse   422 TIL--IQTN--------QLTGEPELHYLRLP--KDISDDHVILMDCTVSTGAAAMMAVRVLLDHD 474

  Fly   222 FDDD----------EDIEHNLASLSPSSSLI-DGLDGEDDD------------DDCEGPELLPDH 263
            ..:|          |...|::|...|...:| ..:|...:|            |...|.:.:||.
Mouse   475 VPEDKIFLLSLLMAEMGVHSVAYAFPRVRIITTAVDKRVNDLFRIIPGIGNFGDRYFGTDAVPDG 539

  Fly   264 DDDLE 268
            .||.|
Mouse   540 SDDDE 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11593NP_001261392.1 BNIP2 <293..342 CDD:289278
CRAL_TRIO_2 345..475 CDD:290435
Uckl1NP_001365934.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..74
UMPK 101..299 CDD:238981 15/69 (22%)
UPRTase 330..533 CDD:405383 40/216 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.