DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11593 and uckl1b

DIOPT Version :9

Sequence 1:NP_001261392.1 Gene:CG11593 / 38477 FlyBaseID:FBgn0035488 Length:484 Species:Drosophila melanogaster
Sequence 2:XP_005162063.1 Gene:uckl1b / 558466 ZFINID:ZDB-GENE-090311-45 Length:537 Species:Danio rerio


Alignment Length:261 Identity:54/261 - (20%)
Similarity:98/261 - (37%) Gaps:60/261 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KMDISETPTDSTGV----------------SP---LADDVLPTAPEKNILKLEQAKQDHDKEELE 61
            :.||:|...|..||                .|   |||.|:|.. ..|::.::...|        
Zfish   227 RRDITERGRDIEGVIKQYNKFVKPAFEQYIEPTMRLADIVVPRG-GGNMVAIDLIVQ-------- 282

  Fly    62 FKTTSALDNRILRPELLPM------EAMPQRHNIIERT--LANSHPLMSPTNTDSDSEPFQLKKQ 118
             ...|.|:.|.||.::..:      :.:||..:::|.|  :...|.::...:|:.|...|..|:.
Zfish   283 -HVHSQLEERKLRWDMAALASAHQAQPLPQTLSVLESTPQVRGMHTIIRNKDTNRDEFIFYSKRL 346

  Fly   119 EKQL---PRSNFPDVVPTTETVQVKNNLNQCRNKPQDAKVSLLRAN---SPDILSSESDADVSQY 177
            .:.|   ..|..|..|...:|.|.::...:..:..:...||:|||.   .|.:.:...|..:.:.
Zfish   347 MRLLIERALSFLPSQVHIVQTPQGEDYEGRIFHGKRITGVSILRAGETMEPALRAVCKDVRIGKI 411

  Fly   178 LAAVESNFQSVSLMPNGNGKKSKRSTALPGGEDISSLDSISNHSFDDDEDIEHNLASLSPSSSLI 242
            |  :::|        ...|:.......||  :|||     .:|....|..:....|::.....|:
Zfish   412 L--IQTN--------QDTGEPELHYLRLP--KDIS-----EDHVILMDCTVSTGAAAMMAIRVLL 459

  Fly   243 D 243
            |
Zfish   460 D 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11593NP_001261392.1 BNIP2 <293..342 CDD:289278
CRAL_TRIO_2 345..475 CDD:290435
uckl1bXP_005162063.1 Udk 81..294 CDD:223645 17/76 (22%)
UMPK 88..287 CDD:238981 14/69 (20%)
UPRTase 318..521 CDD:291353 32/160 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.