DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11593 and nmrk2

DIOPT Version :9

Sequence 1:NP_001261392.1 Gene:CG11593 / 38477 FlyBaseID:FBgn0035488 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_001314713.1 Gene:nmrk2 / 447879 ZFINID:ZDB-GENE-040912-44 Length:198 Species:Danio rerio


Alignment Length:96 Identity:20/96 - (20%)
Similarity:38/96 - (39%) Gaps:25/96 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GVSPLADDVLPTAPEKNILKLEQAKQDHDKEEL------EFKTTSALDNRILRPELLPMEAMPQR 86
            |.:.|...::...|...::..:...:..|:.||      ::...:|||          |:||.  
Zfish    14 GKTTLTGRLIKNLPNCCVVHQDDFFKPQDQIELGEDGFRQWDVITALD----------MDAMV-- 66

  Fly    87 HNIIERTLAN------SHPLMSPTNTDSDSE 111
             |.::..:.|      ||.:...|.:|.||:
Zfish    67 -NTVKGWMENPVKFARSHGVSVSTTSDPDSD 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11593NP_001261392.1 BNIP2 <293..342 CDD:289278
CRAL_TRIO_2 345..475 CDD:290435
nmrk2NP_001314713.1 NRK1 4..167 CDD:238982 20/96 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.