DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11593 and Uck

DIOPT Version :9

Sequence 1:NP_001261392.1 Gene:CG11593 / 38477 FlyBaseID:FBgn0035488 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_001138105.1 Gene:Uck / 42894 FlyBaseID:FBgn0263398 Length:305 Species:Drosophila melanogaster


Alignment Length:226 Identity:48/226 - (21%)
Similarity:80/226 - (35%) Gaps:73/226 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 TAPEKNILKLEQAKQDHDKEELEFKTTSALDNRILRPELLPMEAMPQRHNIIERTLAN-SHPLMS 102
            |..:|.:.:|.||:.||.:.::    .|...:...| ||.|.|...     .::.|.| .||   
  Fly    42 TVCKKIMEQLGQAEMDHTQRQV----VSISQDSFYR-ELTPAEKAK-----AQKGLFNFDHP--- 93

  Fly   103 PTNTDSDSEPFQ-------LKKQEKQLP----RSN----------FP-DVV----------PTTE 135
                |:.:|...       ||..:.::|    |:|          :| |||          |...
  Fly    94 ----DAFNEELMYSTLQNILKGHKVEIPSYDYRTNSLDFENVLVIYPADVVLFEGILVFYFPKIR 154

  Fly   136 T-------VQVKNNLNQCRNKPQDAKVSLLRANSPDILSSESDADVSQYLAAVESNFQSVSLMPN 193
            .       |...::....|..|:|     :.....|:     ||.::||:..|:..|:...    
  Fly   155 ELFHMKLFVDTDSDTRLARRVPRD-----INERGRDL-----DAVLTQYMTFVKPAFEEFC---- 205

  Fly   194 GNGKKSKRSTALPGGEDIS-SLDSISNHSFD 223
             :..|......:|.|.|.: ::|.|..|..|
  Fly   206 -SPTKKFADVIIPRGADNTVAIDLIVQHIRD 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11593NP_001261392.1 BNIP2 <293..342 CDD:289278
CRAL_TRIO_2 345..475 CDD:290435
UckNP_001138105.1 UMPK 29..235 CDD:238981 47/224 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.