DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11593 and uck2b

DIOPT Version :9

Sequence 1:NP_001261392.1 Gene:CG11593 / 38477 FlyBaseID:FBgn0035488 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_956058.1 Gene:uck2b / 327057 ZFINID:ZDB-GENE-030131-5265 Length:261 Species:Danio rerio


Alignment Length:43 Identity:9/43 - (20%)
Similarity:23/43 - (53%) Gaps:2/43 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 SRNWQKITLPDGRTREIDMRVIEPYKRVLSHGGYLK--SGGQN 345
            ::.:..:.:|.|....:.:.:|..:.:.:.:||:.|  :|.||
Zfish   202 TKKYADVIIPRGADNLVAINLIVQHIQDILN
GGFTKRQNGFQN 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11593NP_001261392.1 BNIP2 <293..342 CDD:289278 6/38 (16%)
CRAL_TRIO_2 345..475 CDD:290435 1/1 (100%)
uck2bNP_956058.1 Udk 17..232 CDD:223645 3/29 (10%)
UMPK 24..230 CDD:238981 3/27 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 238..261 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.