powered by:
Protein Alignment CG11593 and uck2b
DIOPT Version :9
Sequence 1: | NP_001261392.1 |
Gene: | CG11593 / 38477 |
FlyBaseID: | FBgn0035488 |
Length: | 484 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_956058.1 |
Gene: | uck2b / 327057 |
ZFINID: | ZDB-GENE-030131-5265 |
Length: | 261 |
Species: | Danio rerio |
Alignment Length: | 43 |
Identity: | 9/43 - (20%) |
Similarity: | 23/43 - (53%) |
Gaps: | 2/43 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 305 SRNWQKITLPDGRTREIDMRVIEPYKRVLSHGGYLK--SGGQN 345
::.:..:.:|.|....:.:.:|..:.:.:.:||:.| :|.||
Zfish 202 TKKYADVIIPRGADNLVAINLIVQHIQDILNGGFTKRQNGFQN 244
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0572 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.