DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11593 and Uck1

DIOPT Version :9

Sequence 1:NP_001261392.1 Gene:CG11593 / 38477 FlyBaseID:FBgn0035488 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_001101301.2 Gene:Uck1 / 311864 RGDID:1308313 Length:283 Species:Rattus norvegicus


Alignment Length:171 Identity:38/171 - (22%)
Similarity:60/171 - (35%) Gaps:43/171 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 DHDDDLELDL---------EFGLATTPTPNAPASATAASTLPQYTA------------AEERRDS 305
            ||.|..:.||         |......||.:....:....|...|.|            .:|.||.
  Rat    93 DHPDAFDNDLMHKTLKNIVEGKTVEVPTYDFVTHSRLPETTVVYPADVVLFEGILVFYTQEIRDM 157

  Fly   306 RNWQKITLPDGRTREIDMRVIEPYKR-------VLSHGGYLKSGGQNAIVIFCACHLPDRSRADY 363
            .:.:.....|...| :..||:...:|       :..:..::|.    |...||   ||.:..||.
  Rat   158 FHLRLFVDTDSDVR-LSRRVLRDVQRGRDLEQILTQYTAFVKP----AFEEFC---LPTKKYADV 214

  Fly   364 SYV--MDNLFL--YVVKTLEQLVTDDYVLIYLH-GGSNRRN 399
            ...  :||:..  .:|:.::.::..|  |...| ||.|.||
  Rat   215 IIPRGVDNMVAINLIVQHIQDILNGD--LCKRHRGGPNGRN 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11593NP_001261392.1 BNIP2 <293..342 CDD:289278 11/67 (16%)
CRAL_TRIO_2 345..475 CDD:290435 18/60 (30%)
Uck1NP_001101301.2 UMPK 31..236 CDD:238981 30/150 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.