DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11593 and arm

DIOPT Version :9

Sequence 1:NP_001261392.1 Gene:CG11593 / 38477 FlyBaseID:FBgn0035488 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_001259149.1 Gene:arm / 31151 FlyBaseID:FBgn0000117 Length:843 Species:Drosophila melanogaster


Alignment Length:329 Identity:66/329 - (20%)
Similarity:108/329 - (32%) Gaps:110/329 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 NSPDI---LSSESDA---DVSQYLAAVESNFQSVSLMPNGNGKKSKRSTALPGGEDISSLDSISN 219
            |.||:   :|::...   ..:.||.....:..:|:.:|:.:||:.:.   :.|...:..||:...
  Fly    18 NPPDLPPMVSAKEQTLMWQQNSYLGDSGIHSGAVTQVPSLSGKEDEE---MEGDPLMFDLDTGFP 79

  Fly   220 HSFDDD--EDIEHNL---------ASLSPSSSLIDGLDGEDDDDDCEGPEL-------------- 259
            .:|..|  :|:...|         |::.| .:|.:|::......|.:.|..              
  Fly    80 QNFTQDQVDDMNQQLSQTRSQRVRAAMFP-ETLEEGIEIPSTQFDPQQPTAVQRLSEPSQMLKHA 143

  Fly   260 ---LPDHDDDLELDLEFGLATTPTP-------------------------NAPASATAASTLPQY 296
               |.::.||.|      |||...|                         ...||..|....||.
  Fly   144 VVNLINYQDDAE------LATRAIPELIKLLNDEDQVVVSQAAMMVHQLSKKEASRHAIMNSPQM 202

  Fly   297 TAAEER--RDSRNWQKITLPDGRTREIDMRVIEPYKRVLSH--GGYL---KSGGQNAIVIFCACH 354
            .||..|  .:|.:.:......|....            |||  .|.|   ||||..|:|..    
  Fly   203 VAALVRAISNSNDLESTKAAVGTLHN------------LSHHRQGLLAIFKSGGIPALVKL---- 251

  Fly   355 LPDRSRADYSYVMDNLFLYVVKTLEQLV---TDDYVLIYLHGG-------SNRRNVPPFPWLKRC 409
                    .|..::::..|.:.||..|:   ....:.:.|.||       ..|.||.....:..|
  Fly   252 --------LSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDC 308

  Fly   410 YQLL 413
            .|:|
  Fly   309 LQIL 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11593NP_001261392.1 BNIP2 <293..342 CDD:289278 13/55 (24%)
CRAL_TRIO_2 345..475 CDD:290435 16/79 (20%)
armNP_001259149.1 Adaptin_N <150..>314 CDD:331138 42/193 (22%)
armadillo repeat 161..186 CDD:293788 1/24 (4%)
armadillo repeat 193..231 CDD:293788 9/49 (18%)
armadillo repeat 238..270 CDD:293788 10/43 (23%)
armadillo repeat 278..314 CDD:293788 9/35 (26%)
armadillo repeat 320..355 CDD:293788
Arm 361..398 CDD:278915
armadillo repeat 362..397 CDD:293788
armadillo repeat 410..435 CDD:293788
Arm 439..481 CDD:278915
armadillo repeat 443..481 CDD:293788
armadillo repeat 490..525 CDD:293788
Arm 597..636 CDD:278915
armadillo repeat 600..636 CDD:293788
armadillo repeat 641..675 CDD:293788
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.