Sequence 1: | NP_001261392.1 | Gene: | CG11593 / 38477 | FlyBaseID: | FBgn0035488 | Length: | 484 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571252.1 | Gene: | jupa / 30415 | ZFINID: | ZDB-GENE-991207-22 | Length: | 729 | Species: | Danio rerio |
Alignment Length: | 286 | Identity: | 70/286 - (24%) |
---|---|---|---|
Similarity: | 98/286 - (34%) | Gaps: | 80/286 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 170 SDADVSQYL--------------AAVESNFQSVSLMPNGNGKKSKRSTALPGGEDISSLDSISNH 220
Fly 221 SFDDDEDIEHNLASLS-PSSSL---IDGLDGEDDDDDCEG---PEL--LPDHDDDLELDLEFGLA 276
Fly 277 TTPTPNAPASATAASTLPQYTAAEERRDSRNWQKITLPDGRTREIDMRVIEPYKRVLSH--GGYL 339
Fly 340 ---KSGGQNAIVIFCACHLPDRSRADYSYVMDNLFLYVVKTLEQLVTDD---YVLIYLHGGSNRR 398
Fly 399 NVPPFPWLKR-----------CYQLL 413 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11593 | NP_001261392.1 | BNIP2 | <293..342 | CDD:289278 | 15/53 (28%) |
CRAL_TRIO_2 | 345..475 | CDD:290435 | 19/83 (23%) | ||
jupa | NP_571252.1 | armadillo repeat | 133..158 | CDD:293788 | 6/25 (24%) |
armadillo repeat | 175..201 | CDD:293788 | 7/35 (20%) | ||
ARM | 209..328 | CDD:237987 | 24/92 (26%) | ||
armadillo repeat | 210..242 | CDD:293788 | 12/43 (28%) | ||
armadillo repeat | 250..286 | CDD:293788 | 10/39 (26%) | ||
armadillo repeat | 292..327 | CDD:293788 | |||
ARM | 330..370 | CDD:214547 | |||
armadillo repeat | 334..369 | CDD:293788 | |||
ARM | 379..498 | CDD:237987 | |||
armadillo repeat | 382..407 | CDD:293788 | |||
armadillo repeat | 415..453 | CDD:293788 | |||
armadillo repeat | 462..497 | CDD:293788 | |||
ARM | 464..600 | CDD:237987 | |||
armadillo repeat | 504..560 | CDD:293788 | |||
armadillo repeat | 565..599 | CDD:293788 | |||
ARM | 568..>645 | CDD:237987 | |||
armadillo repeat | 607..637 | CDD:293788 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0572 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |