DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11593 and jupa

DIOPT Version :9

Sequence 1:NP_001261392.1 Gene:CG11593 / 38477 FlyBaseID:FBgn0035488 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_571252.1 Gene:jupa / 30415 ZFINID:ZDB-GENE-991207-22 Length:729 Species:Danio rerio


Alignment Length:286 Identity:70/286 - (24%)
Similarity:98/286 - (34%) Gaps:80/286 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 SDADVSQYL--------------AAVESNFQSVSLMPNGNGKKSKRSTALPGGEDISSLDSISNH 220
            ||.|.::|.              |.|||..         |..:::|..|....|.:  ::....|
Zfish    37 SDDDGTEYSSKKFTYTTTFTENPAEVESQL---------NMTRAQRVRAAMFPETV--MEGSVIH 90

  Fly   221 SFDDDEDIEHNLASLS-PSSSL---IDGLDGEDDDDDCEG---PEL--LPDHDDDLELDLEFGLA 276
            |...|...:.|:..|: ||..|   |..|....||.:...   |||  |.:.:|.|.:: :..:.
Zfish    91 STQIDPSQQTNVQKLAEPSQQLKAAIVHLINYQDDAELATRAIPELTKLLNDEDQLVVN-KAAMI 154

  Fly   277 TTPTPNAPASATAASTLPQYTAAEERRDSRNWQKITLPDGRTREIDMRVIEPYKRVLSH--GGYL 339
            ........||..|....||..||..|.    .|..|  |..|......::..    |||  .|.|
Zfish   155 VNQLTRKEASRRALMQSPQMVAAVVRA----MQNTT--DMETTRATASILHN----LSHQREGLL 209

  Fly   340 ---KSGGQNAIVIFCACHLPDRSRADYSYVMDNLFLYVVKTLEQLVTDD---YVLIYLHGGSNRR 398
               ||||..|:|..            .|..||::..|.:.||..|:...   .:.:.|..|..|.
Zfish   210 AIFKSGGIPALVRM------------LSSPMDSVLFYAITTLHNLLLHQEGAKMAVRLADGLQRM 262

  Fly   399 NVPPFPWLKR-----------CYQLL 413
                .|.||:           |.|||
Zfish   263 ----VPLLKKSNPKFLAITTDCLQLL 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11593NP_001261392.1 BNIP2 <293..342 CDD:289278 15/53 (28%)
CRAL_TRIO_2 345..475 CDD:290435 19/83 (23%)
jupaNP_571252.1 armadillo repeat 133..158 CDD:293788 6/25 (24%)
armadillo repeat 175..201 CDD:293788 7/35 (20%)
ARM 209..328 CDD:237987 24/92 (26%)
armadillo repeat 210..242 CDD:293788 12/43 (28%)
armadillo repeat 250..286 CDD:293788 10/39 (26%)
armadillo repeat 292..327 CDD:293788
ARM 330..370 CDD:214547
armadillo repeat 334..369 CDD:293788
ARM 379..498 CDD:237987
armadillo repeat 382..407 CDD:293788
armadillo repeat 415..453 CDD:293788
armadillo repeat 462..497 CDD:293788
ARM 464..600 CDD:237987
armadillo repeat 504..560 CDD:293788
armadillo repeat 565..599 CDD:293788
ARM 568..>645 CDD:237987
armadillo repeat 607..637 CDD:293788
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.