DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11593 and B0001.4

DIOPT Version :9

Sequence 1:NP_001261392.1 Gene:CG11593 / 38477 FlyBaseID:FBgn0035488 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_502304.2 Gene:B0001.4 / 178160 WormBaseID:WBGene00007089 Length:248 Species:Caenorhabditis elegans


Alignment Length:181 Identity:37/181 - (20%)
Similarity:60/181 - (33%) Gaps:50/181 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 NGNGKKSKRSTALPGGEDISSLDSISNHSFDDDEDIEHNLASLSPSSSLIDGLDGEDDDDDCEGP 257
            |.|.|:|.|..      ||..|   |.|||..:...|..:.:.....:.                
 Worm    33 NANAKQSGRQI------DIVHL---SLHSFYRELSAEEKILAREGKFNF---------------- 72

  Fly   258 ELLPDHDDDLELDLEFGLATT-------PTPNAPASATAASTLPQYTAAEERRDSRNWQKITLPD 315
                ||.|.:..||   ||.|       .|...|......|::......|.       .|:.:.:
 Worm    73 ----DHPDQINFDL---LAETLQNMIDGKTVEIPKYDMITSSMNGTVTVEP-------AKVIIIE 123

  Fly   316 GRTREIDMRVIEPYKRVLSHGGYLKSGGQNAIVIFCACHLPDRSRADYSYV 366
            |.....|.||    :::||...:::...::.:....|.::.|..||..|.:
 Worm   124 GILLLYDERV----RKLLSTKLFVEKNAESRLRNRLATYIRDYHRAPLSII 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11593NP_001261392.1 BNIP2 <293..342 CDD:289278 8/48 (17%)
CRAL_TRIO_2 345..475 CDD:290435 5/22 (23%)
B0001.4NP_502304.2 Udk 1..223 CDD:223645 37/181 (20%)
UMPK 10..216 CDD:238981 37/181 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.