DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11593 and sh3bp1

DIOPT Version :10

Sequence 1:NP_647851.3 Gene:CG11593 / 38477 FlyBaseID:FBgn0035488 Length:484 Species:Drosophila melanogaster
Sequence 2:XP_031756949.1 Gene:sh3bp1 / 101733422 XenbaseID:XB-GENE-984798 Length:636 Species:Xenopus tropicalis


Alignment Length:197 Identity:39/197 - (19%)
Similarity:66/197 - (33%) Gaps:75/197 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PSESKMDISET--------PTDSTGVS----PLADDVLPTAPEKNILKLEQAKQDH--DKEEL-E 61
            |.:....:||.        |...:|:.    |.|::.  ..|..|:.:..::..:.  :.||| :
 Frog   459 PEDVDFGVSEAYHETSSVLPAQCSGIKNQEWPKAEET--ALPPSNVSENTESVSESLTEWEELIK 521

  Fly    62 FKTTSALD-------------------NRILRPELLPMEAMPQRHNIIERTLANSHPLMSPTNTD 107
            |.|:.||.                   .::.||       .|||.||....    .|..:|...:
 Frog   522 FSTSKALPPIEESYSTIQKSEGSPTTVRKVKRP-------APQRPNIPPPV----QPRANPETAE 575

  Fly   108 SDSEPFQLKKQEKQLPRSNFPDVVPTTETVQVKNNLNQCRNKPQDAKVSLLRANSPDILSSESDA 172
            |.|.|       |.:||.:.      :.:::|.       |||.        .:.|.|..|..:.
 Frog   576 SHSSP-------KPIPRRSM------SGSLKVP-------NKPP--------PHPPQITKSLGEG 612

  Fly   173 DV 174
            |:
 Frog   613 DI 614

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11593NP_647851.3 BNIP2 <293..342 CDD:463609
CRAL_TRIO_2 345..475 CDD:463965
sh3bp1XP_031756949.1 BAR 16..250 CDD:472257
RhoGAP 263..462 CDD:470621 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.