DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11593 and Nmrk2

DIOPT Version :9

Sequence 1:NP_001261392.1 Gene:CG11593 / 38477 FlyBaseID:FBgn0035488 Length:484 Species:Drosophila melanogaster
Sequence 2:XP_003750325.2 Gene:Nmrk2 / 100912521 RGDID:6486791 Length:229 Species:Rattus norvegicus


Alignment Length:194 Identity:42/194 - (21%)
Similarity:66/194 - (34%) Gaps:67/194 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 PQYTAAEERRDSRNWQKITLPDGRTREIDMR---------VIEPYKRVLSHGGYLKSGGQNAIVI 349
            ||...|......:.|..:       ..:||.         |.:|:|...:||..|:.|..:..::
  Rat    74 PQDQIAVGEDGFKQWDVL-------ESLDMEAMLSTVQAWVKDPHKFARAHGVSLQPGASDTHIL 131

  Fly   350 FCACHLPDRSRADYSYVMDNLFLYVVKTLEQLVTDDYVLIYLHGGSNRRNVPPFPWLKRCYQLLD 414
                            :::...||..|.|..|....|.|          .||    .:.|     
  Rat   132 ----------------LLEGFLLYSYKPLVDLYNQRYFL----------TVP----YEEC----- 161

  Fly   415 RRLRKSLKHMYLVHPTFWIKSLVWMARPFVSTKFWRKL-------VYV---KSLEELGMHVVVE 468
            :|.|:|..:| :..|.......||   |... |:.|::       ||:   ||.|.| :|.|:|
  Rat   162 KRRRRSRTYM-VPDPPGLFDGHVW---PMYQ-KYKREMERDRVEVVYLDGTKSREGL-VHQVLE 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11593NP_001261392.1 BNIP2 <293..342 CDD:289278 12/56 (21%)
CRAL_TRIO_2 345..475 CDD:290435 29/134 (22%)
Nmrk2XP_003750325.2 NRK1 38..197 CDD:238982 33/169 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.