DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11594 and RPT1

DIOPT Version :9

Sequence 1:NP_001261391.1 Gene:CG11594 / 38473 FlyBaseID:FBgn0035484 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_012777.1 Gene:RPT1 / 853712 SGDID:S000001628 Length:467 Species:Saccharomyces cerevisiae


Alignment Length:359 Identity:72/359 - (20%)
Similarity:115/359 - (32%) Gaps:133/359 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 ATCSLVVLGPQGSPLTV---SKSGEAEQNIILWMDHRAEQETQEINAFKHSLLKYVGGQVSLEME 141
            |.|:.::.|...|..|.   :.||.:..|        :.|::.:.:..... .|||   ::|:..
Yeast   100 ARCTKIIKGNGESDETTTDNNNSGNSNSN--------SNQQSTDADEDDED-AKYV---INLKQI 152

  Fly   142 VPKLLWLKRNLSQTFGNIWRVFDLPDFLTWRATGVDTRSLCSVVCKWN----------------- 189
            ...::.|...:|.|           |.......||| ||      |:|                 
Yeast   153 AKFVVGLGERVSPT-----------DIEEGMRVGVD-RS------KYNIELPLPPRIDPSVTMMT 199

  Fly   190 --------YDAANGSWNK-EFLKQ-ADLEELTQNNFEKLGSD-------VQPPGRTVGKGLTAKA 237
                    |....|..:: |.|:: .:|..|:...|..||.|       ..|||  .||.|.|:|
Yeast   200 VEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPG--TGKTLCARA 262

  Fly   238 -AGELGLSAGTVVSTSLIDAHAGALGMFGCRSKESKGADDVQGKMALIAGTSTCHMSITRKACFA 301
             |.....:...|:.:.|:..:.|            :||..|:         ....|:.|:|||. 
Yeast   263 VANRTDATFIRVIGSELVQKYVG------------EGARMVR---------ELFEMARTKKACI- 305

  Fly   302 QGVWGPYQDAIIPGYFLNEGGQSIAGHLLDHVLKSHESYAELKSQLGEDKFIYQHLNKLLPELAA 366
              ::....||:        ||                  |......|.|..:.:.:.:|:.:|..
Yeast   306 --IFFDEIDAV--------GG------------------ARFDDGAGGDNEVQRTMLELITQLDG 342

  Fly   367 --ARGLSQVGCLTQDVHVWPDLHGNRSPIADPTL 398
              .||..:|...|           ||....||.|
Yeast   343 FDPRGNIKVMFAT-----------NRPNTLDPAL 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11594NP_001261391.1 FGGY_YpCarbK_like 5..540 CDD:212663 72/359 (20%)
5C_CHO_kinase 6..540 CDD:273552 72/359 (20%)
RPT1NP_012777.1 RPT1 28..464 CDD:224143 72/359 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.