DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11594 and RPT2

DIOPT Version :9

Sequence 1:NP_001261391.1 Gene:CG11594 / 38473 FlyBaseID:FBgn0035484 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_010277.1 Gene:RPT2 / 851557 SGDID:S000002165 Length:437 Species:Saccharomyces cerevisiae


Alignment Length:265 Identity:56/265 - (21%)
Similarity:88/265 - (33%) Gaps:80/265 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 VIGGVDKSKVKGIGFDATCSLVVLGPQGSPLTVSKSGE---------AEQNIILWMDHRAEQETQ 119
            |..|.||.|.||..         ..|:..|...||.|.         ||:...::...|.:.:..
Yeast     5 VSSGQDKKKKKGSN---------QKPKYEPPVQSKFGRKKRKGGPATAEKLPNIYPSTRCKLKLL 60

  Fly   120 EINAFKHSLL---KYVGGQVSLEMEVPKLLWLKRNLSQTFGN------IWRVFD----------L 165
            .:...|..||   ::|.....|:....|....|:.|.:..||      :..:.|          :
Yeast    61 RMERIKDHLLLEEEFVSNSEILKPFEKKQEEEKKQLEEIRGNPLSIGTLEEIIDDDHAIVTSPTM 125

  Fly   166 PDFLTWRATGVDTRSL---CSV----------------------VCKW------NYDAANG--SW 197
            ||:.....:.||...|   |||                      |.|.      :|....|  |.
Yeast   126 PDYYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDADPMVSVMKMDKSPTESYSDIGGLESQ 190

  Fly   198 NKEFLKQADLEELTQNNFEKLGSDVQPPGRTV-------GKGLTAKA-AGELGLSAGTVVSTSLI 254
            .:|..:..:|.......:|::|  ::||...:       ||.|.||| |.:...:...:|.:.||
Yeast   191 IQEIKESVELPLTHPELYEEMG--IKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRIVGSELI 253

  Fly   255 DAHAG 259
            ..:.|
Yeast   254 QKYLG 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11594NP_001261391.1 FGGY_YpCarbK_like 5..540 CDD:212663 56/265 (21%)
5C_CHO_kinase 6..540 CDD:273552 56/265 (21%)
RPT2NP_010277.1 PTZ00361 1..437 CDD:185575 56/265 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.