DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11594 and PSMC5

DIOPT Version :9

Sequence 1:NP_001261391.1 Gene:CG11594 / 38473 FlyBaseID:FBgn0035484 Length:548 Species:Drosophila melanogaster
Sequence 2:XP_024306608.1 Gene:PSMC5 / 5705 HGNCID:9552 Length:433 Species:Homo sapiens


Alignment Length:387 Identity:79/387 - (20%)
Similarity:134/387 - (34%) Gaps:116/387 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 GSWNKEFLKQADLEELTQNNFEKLGSDVQPPGR---TVGKGL---TAKAAGELGLSAGTVVSTSL 253
            ||:..|.::..|.        :|:...|.|.|:   .|.|.:   ....|||:.:..|:.::..|
Human    70 GSYVGEVVRAMDK--------KKVLVKVHPEGKFVVDVDKNIDINDVSVAGEVVVVVGSALTVPL 126

  Fly   254 IDAHAGALGMF-----GCRSKESKGADDVQGKMALIAGTSTCHMSITRKACFAQGVWGPYQDAII 313
            :     .|..|     .||             :||...:.|.|..:..|.           |.::
Human   127 L-----KLAPFTQVTPNCR-------------VALRNDSYTLHKILPNKV-----------DPLV 162

  Fly   314 PGYFLNEGGQSIAGHLLDHVLKSHESYAELKSQLGEDKFIYQHLNKLLPELAAARGLSQ-VGCLT 377
            ....:.:...|           ::|....|..|:.|.|.:.: |....|||..|.|::| .|.| 
Human   163 SLMMVEKVPDS-----------TYEMIGGLDKQIKEIKEVIE-LPVKHPELFEALGIAQPKGVL- 214

  Fly   378 QDVHVWPDLHGNRSPIADPTL--RGVITGLDMT----RGTESLAIKYLAFVQALAYGTRHIIENL 436
                    |:|  .|....||  |.|....|.|    .|:| |..|:      :..|.| ::..|
Human   215 --------LYG--PPGTGKTLLARAVAHHTDCTFIRVSGSE-LVQKF------IGEGAR-MVREL 261

  Fly   437 YQYGRAPFQTLLFC------------GGLAKNPLYVQCHADICN-LPALIPDEQEMVLVGAAALG 488
            :...|....:::|.            ||...:....:...::.| |......:...|::      
Human   262 FVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIM------ 320

  Fly   489 AAASGHFDSLESASKSMGGTGQLVK---PNAET----LEFHNRKYKVFLQLLENQRQYRRIM 543
              |:...|.|:||....|...:.::   ||.|.    |:.|:||..:...:  |.|:...:|
Human   321 --ATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGI--NLRKIAELM 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11594NP_001261391.1 FGGY_YpCarbK_like 5..540 CDD:212663 78/382 (20%)
5C_CHO_kinase 6..540 CDD:273552 78/382 (20%)
PSMC5XP_024306608.1 RPT1 4..431 CDD:224143 79/387 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.