DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11594 and Kat60

DIOPT Version :9

Sequence 1:NP_001261391.1 Gene:CG11594 / 38473 FlyBaseID:FBgn0035484 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_001262276.1 Gene:Kat60 / 53566 FlyBaseID:FBgn0040208 Length:605 Species:Drosophila melanogaster


Alignment Length:83 Identity:24/83 - (28%)
Similarity:33/83 - (39%) Gaps:13/83 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 VQPPGRTVGKGLTAKA-AGELGLSAGTVVSTSLIDAHAGALGMFGCRSKESKGADDVQGKMALIA 285
            |.|||  .||.:.||| |.|.|.:...|.|.:|...:.|          ||:....:..:||...
  Fly   365 VGPPG--TGKTMLAKAVATECGTTFFNVSSATLTSKYRG----------ESEKMVRLLFEMARFY 417

  Fly   286 GTSTCHMSITRKACFAQG 303
            ..||..:......|..:|
  Fly   418 APSTIFIDEIDSLCSRRG 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11594NP_001261391.1 FGGY_YpCarbK_like 5..540 CDD:212663 24/83 (29%)
5C_CHO_kinase 6..540 CDD:273552 24/83 (29%)
Kat60NP_001262276.1 HCV_NS5a_C <163..243 CDD:289693
P-loop_NTPase 325..>381 CDD:304359 9/17 (53%)
AAA 358..496 CDD:214640 24/83 (29%)
AAA 362..495 CDD:278434 24/83 (29%)
Vps4_C <570..603 CDD:286426
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.