DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11594 and Kat60

DIOPT Version :10

Sequence 1:NP_647848.2 Gene:CG11594 / 38473 FlyBaseID:FBgn0035484 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_001262276.1 Gene:Kat60 / 53566 FlyBaseID:FBgn0040208 Length:605 Species:Drosophila melanogaster


Alignment Length:83 Identity:24/83 - (28%)
Similarity:33/83 - (39%) Gaps:13/83 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 VQPPGRTVGKGLTAKA-AGELGLSAGTVVSTSLIDAHAGALGMFGCRSKESKGADDVQGKMALIA 285
            |.|||  .||.:.||| |.|.|.:...|.|.:|...:.|          ||:....:..:||...
  Fly   365 VGPPG--TGKTMLAKAVATECGTTFFNVSSATLTSKYRG----------ESEKMVRLLFEMARFY 417

  Fly   286 GTSTCHMSITRKACFAQG 303
            ..||..:......|..:|
  Fly   418 APSTIFIDEIDSLCSRRG 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11594NP_647848.2 5C_CHO_kinase 6..540 CDD:273552 24/83 (29%)
Kat60NP_001262276.1 Kp60-NTD 62..129 CDD:439297
PHA03291 <167..>253 CDD:223033
SpoVK 219..566 CDD:440232 24/83 (29%)
RecA-like_KTNA1 327..493 CDD:410930 24/83 (29%)
Vps4_C <570..603 CDD:462762
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.