Sequence 1: | NP_001261391.1 | Gene: | CG11594 / 38473 | FlyBaseID: | FBgn0035484 | Length: | 548 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001003740.1 | Gene: | psmc5 / 445285 | ZFINID: | ZDB-GENE-030131-6547 | Length: | 406 | Species: | Danio rerio |
Alignment Length: | 218 | Identity: | 45/218 - (20%) |
---|---|---|---|
Similarity: | 72/218 - (33%) | Gaps: | 79/218 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 27 RVLEQAVQTIQTWNPEPGYYNQSSDNIWQSICQVVKKVIGGVDKSKVKGIGFDATCSLVVLGPQG 91
Fly 92 SPLTVSKSGEAEQNIILWMDHRAEQETQEINAFKHSLLKYVGGQVSLEMEVPKLLWLKRNLSQTF 156
Fly 157 GNIWRVFDLPDFLTWRATGVDTRSLCSVVCKWNYDAANGSWNKEFLKQADLEELTQNNFEKLGSD 221
Fly 222 -------VQPPGRTVGKGLTAKA 237 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11594 | NP_001261391.1 | FGGY_YpCarbK_like | 5..540 | CDD:212663 | 45/218 (21%) |
5C_CHO_kinase | 6..540 | CDD:273552 | 45/218 (21%) | ||
psmc5 | NP_001003740.1 | RPT1 | 4..404 | CDD:224143 | 45/218 (21%) |
AAA_16 | 153..>206 | CDD:289934 | 17/70 (24%) | ||
AAA | 186..318 | CDD:278434 | 8/19 (42%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0554 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |