DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11594 and Rpt6R

DIOPT Version :9

Sequence 1:NP_001261391.1 Gene:CG11594 / 38473 FlyBaseID:FBgn0035484 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_651811.1 Gene:Rpt6R / 43635 FlyBaseID:FBgn0039788 Length:399 Species:Drosophila melanogaster


Alignment Length:231 Identity:50/231 - (21%)
Similarity:76/231 - (32%) Gaps:105/231 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RVLEQAVQTIQTWNPEPGYYNQSSDNIWQSICQVVKKVIGGVDKSKVKGIGFDATCSLVVLGPQG 91
            |:|.:.:|.:|    |.|.|          |.:|||.    :||:||          ||.:.|:|
  Fly    51 RLLREELQLLQ----EQGSY----------IAEVVKP----MDKNKV----------LVKVHPEG 87

  Fly    92 SPLTVSKSGEAEQNIILWMDHRAEQETQEINAFKHSLLKYVGGQVSLEMEVPKLLWLK------- 149
                                                  |||       ::|.|.:.:|       
  Fly    88 --------------------------------------KYV-------VDVDKTINIKDVTPSSR 107

  Fly   150 ---RNLSQTFGNIWRVFDLPDFLTWRATGVDTRSLCSVVCKWNYDAANGSWNKEFLKQADLEELT 211
               ||.|.|...|     ||:    :...:.:..|...|....|:.. |..:|:..:..::.||.
  Fly   108 VALRNESYTLHKI-----LPN----KVDPLVSLMLVEKVPDSTYEMV-GGLDKQIQEIKEVIELP 162

  Fly   212 QNN---FEKLGSD-------VQPPGRTVGKGLTAKA 237
            ..:   |:.||..       ..|||  .||.|.|:|
  Fly   163 VKHPELFDALGITQPKGVLLYGPPG--TGKTLLARA 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11594NP_001261391.1 FGGY_YpCarbK_like 5..540 CDD:212663 50/231 (22%)
5C_CHO_kinase 6..540 CDD:273552 50/231 (22%)
Rpt6RNP_651811.1 RPT1 3..396 CDD:224143 50/231 (22%)
AAA 180..311 CDD:278434 8/19 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.