DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11594 and Rpt2

DIOPT Version :9

Sequence 1:NP_001261391.1 Gene:CG11594 / 38473 FlyBaseID:FBgn0035484 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_001287493.1 Gene:Rpt2 / 42828 FlyBaseID:FBgn0015282 Length:439 Species:Drosophila melanogaster


Alignment Length:253 Identity:54/253 - (21%)
Similarity:80/253 - (31%) Gaps:85/253 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 VDKSKVKGIGFDATCSLVVLGPQGSPLTVSKSGEAEQNIILWMDHRAEQETQEINAFKHSLL--- 129
            |.|.|.:..|.||...|    ||.:|.|                 |...:..::...|..|:   
  Fly    32 VGKKKRRAKGPDAAMKL----PQVTPHT-----------------RCRLKLLKLERIKDYLMMED 75

  Fly   130 KYVGGQVSL-------EMEVPKLLWLKRNLSQTFGNIWRVFDLPDFLTWRATG----------VD 177
            :::..|..|       |.|..|:..| |....:.||:..:.|....:...:.|          ||
  Fly    76 EFIRNQERLKPQDEKNEEERSKVDDL-RGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVD 139

  Fly   178 TRSL---CSVVCKWNYDAANGSWNKE---FLKQADLEELTQNNFEKLGS-DVQ------------ 223
            ...|   |||:......|..|..:.:   .:....||:..|..:..:|. |.|            
  Fly   140 KDQLEPGCSVLLNHKVHAVVGVLSDDTDPMVTVMKLEKAPQETYADIGGLDTQIQEIKESVELPL 204

  Fly   224 ---------------------PPGRTVGKGLTAKA-AGELGLSAGTVVSTSLIDAHAG 259
                                 |||  .||.|.||| |.:...:...||.:.||..:.|
  Fly   205 THPEYYEEMGIKPPKGVILYGPPG--TGKTLLAKAVANQTSATFLRVVGSELIQKYLG 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11594NP_001261391.1 FGGY_YpCarbK_like 5..540 CDD:212663 54/253 (21%)
5C_CHO_kinase 6..540 CDD:273552 54/253 (21%)
Rpt2NP_001287493.1 PTZ00361 1..439 CDD:185575 54/253 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.