DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11594 and psmc1b

DIOPT Version :9

Sequence 1:NP_001261391.1 Gene:CG11594 / 38473 FlyBaseID:FBgn0035484 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_001002091.1 Gene:psmc1b / 415181 ZFINID:ZDB-GENE-040625-69 Length:440 Species:Danio rerio


Alignment Length:338 Identity:62/338 - (18%)
Similarity:110/338 - (32%) Gaps:121/338 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 GCRSKESKGADDVQGKMALIAGTSTCHMSITRKACFAQGVWGPYQDAIIPGYFLNEGGQSIAGHL 329
            |.|.::||| .|...|:.|:...:.|.:.:.:            ||. |..|.|.|         
Zfish    34 GKRKRKSKG-PDAASKLPLVTPHTQCRLKLLK------------QDR-IKDYLLME--------- 75

  Fly   330 LDHVLKSHESYAELKSQLGEDKFIYQHLNKLLPELAAARGLSQVGCLTQDVHVWPDLHGNRSPIA 394
             :..:::.|....|:.:..|::                   |:|          .||.|  :|::
Zfish    76 -EEFIRNQEQMKPLEEKQEEER-------------------SKV----------DDLRG--TPMS 108

  Fly   395 DPTLRGVITGLDMTRGTESLAIKYLAFVQALAYGTRHIIE------------------------- 434
            ..||..:|   |......|.::....:|..|::..:.::|                         
Zfish   109 VGTLEEII---DDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVLMDDTDPL 170

  Fly   435 -NLYQYGRAPFQTLLFCGGLAKNPLYVQCHADICNLPALIPDEQE---------MVLVGAAALG- 488
             .:.:..:||.:|....|||...   :|...:...||...|:..|         ::|.||...| 
Zfish   171 VTVMKVEKAPQETYADIGGLDNQ---IQEIKESVELPLTHPEYYEEMGIKPPKGVILYGAPGTGK 232

  Fly   489 ---AAASGHFDSL--------ESASKSMGGTGQLVKPNAETLEFHNRKYKVFLQLLE-------- 534
               |.|..:..|.        |...|.:|...:||:......|.|.... ||:..::        
Zfish   233 TLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSI-VFIDEIDAIGTKRYD 296

  Fly   535 ----NQRQYRRIM 543
                .:|:.:|.|
Zfish   297 SNSGGEREIQRTM 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11594NP_001261391.1 FGGY_YpCarbK_like 5..540 CDD:212663 60/333 (18%)
5C_CHO_kinase 6..540 CDD:273552 60/333 (18%)
psmc1bNP_001002091.1 PTZ00361 1..440 CDD:185575 62/338 (18%)
Prot_ATP_ID_OB 108..>176 CDD:293059 8/70 (11%)
AAA 222..355 CDD:278434 19/89 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.