DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11594 and psmc2

DIOPT Version :9

Sequence 1:NP_001261391.1 Gene:CG11594 / 38473 FlyBaseID:FBgn0035484 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_957260.1 Gene:psmc2 / 393941 ZFINID:ZDB-GENE-040426-1327 Length:433 Species:Danio rerio


Alignment Length:111 Identity:22/111 - (19%)
Similarity:40/111 - (36%) Gaps:32/111 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 GFDATCSLVVLGPQGSPLTVS----KSGEAEQNIILWMDHRAEQETQEINAFKHSLLKYVGGQVS 137
            |||...::.||.....|.|:.    :.|.        :|.:.|....::....| :.|.....:|
Zfish   308 GFDPRGNIKVLMATNRPDTLDPALMRPGR--------LDRKIEFSLPDLEGRTH-IFKIHARSMS 363

  Fly   138 LEMEVPKLLWLKRNLSQTFGNIWRVFDLPDFLTWRATGVDTRSLCS 183
            :|.::.                   |:|...|...:||.:.||:|:
Zfish   364 VERDIR-------------------FELLARLCPNSTGAEIRSVCT 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11594NP_001261391.1 FGGY_YpCarbK_like 5..540 CDD:212663 22/111 (20%)
5C_CHO_kinase 6..540 CDD:273552 22/111 (20%)
psmc2NP_957260.1 RPT1 23..430 CDD:224143 22/111 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.