DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11594 and CG1271

DIOPT Version :9

Sequence 1:NP_001261391.1 Gene:CG11594 / 38473 FlyBaseID:FBgn0035484 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_647763.1 Gene:CG1271 / 38364 FlyBaseID:FBgn0035392 Length:556 Species:Drosophila melanogaster


Alignment Length:565 Identity:118/565 - (20%)
Similarity:198/565 - (35%) Gaps:152/565 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SGP-----FFVGVDVGTGSARAALVACDGRVLEQAVQTIQTWNPEPGYYNQSSDNIWQSICQVVK 62
            |||     |.:.:||||...|:.::.....|...||..::..||:|||:....:::|:.|..|:.
  Fly    24 SGPPDSPAFILALDVGTTCVRSFVLDEQCEVRGSAVDAVELLNPQPGYFEIEPESLWRKIVGVIT 88

  Fly    63 KVIGGVDKSKVKGIGFDATCSLVVLGPQGSPLTVS-----------KSGEAEQNIILWMDHRAEQ 116
            :.:.....:..     |.||           ||:|           :|||...|.|.|.|.||::
  Fly    89 QAVKNAQLTPP-----DITC-----------LTISTQRCTFLTWDHRSGEYYHNFITWKDLRADE 137

  Fly   117 ETQEINA---------FKH--------------SLLKYVGGQVSLEMEVPKLLW-------LKRN 151
            ...:.||         |.:              |:|:.:.|||:     |:||:       ||:.
  Fly   138 LVDQWNASWTKSSMNWFSYALFLLTRQSRFLAGSVLQLMNGQVT-----PRLLFEIMNNKKLKQA 197

  Fly   152 LSQTFGNI-----W-------------RVFDLPDFLTWRATGVDTRSLCSVVCKWNYDAANGSWN 198
            |.|....:     |             .|..:.|..:..|||:             ||....||:
  Fly   198 LMQKKARVELLDSWILHKLRTGSSRDKDVEHITDVTSSTATGL-------------YDPFTLSWS 249

  Fly   199 KEF-----LKQADLEELTQNNFEKLGSDVQPPGRTVGKGLTAKAAGELGLSAGTVVSTSLIDAHA 258
            ...     :....|..:..|.::..| .|.|           .|.|....:....::.||.|..|
  Fly   250 PLISWLFGINSKILPRVVDNGYKGFG-HVHP-----------TAFGPDWANTEIPIAASLSDQTA 302

  Fly   259 GALGMFGCRSKESKGADDVQGKMALIAGTSTCHMSITRKACFAQGVWGPYQDAIIPGYFLNEGGQ 323
            ...|. .|..|     :||:..|    ||......:|...|.|. :.|.|  .::...|.....|
  Fly   303 AIWGS-QCFQK-----NDVKVTM----GTGAFLNLVTGDRCQAV-ISGMY--PLVAWQFKKPTRQ 354

  Fly   324 SIAGHLLDHVLKSHE-----SYAELKSQLGEDKFIYQHLNKLLPELAAARGLSQVGCLTQDVHVW 383
            ..|.:.::..  ||:     ::|: ..:|.:.......:.:.:|:             |.||...
  Fly   355 QGAVYCIEGA--SHDFGTVVTWAQ-SCELFDSPANTSDIAQSVPD-------------TNDVFFM 403

  Fly   384 PDLHGNRSPIADPTLRGVITGLDMTRGTESLAIKYLAFVQALAYGTRHIIENLYQYGRAPFQTLL 448
            |...|...|:.|  .|.....:.:|..| :.|....|.::::.:....:||...:........:.
  Fly   404 PAFSGLGPPVND--YRSASGFIGLTPST-TKAHMVRALLESIVFRLVQLIEAAEKETSQKLHMIR 465

  Fly   449 FCGGLAKNPLYVQCHADICNLPALIPDEQEMVLVGAAALGAAASG 493
            ..||:::|....|..||:..|.....|..|..::||..:.....|
  Fly   466 VDGGVSRNDFVCQFLADLSRLRVERADNAESSIMGATFMAGINLG 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11594NP_001261391.1 FGGY_YpCarbK_like 5..540 CDD:212663 116/563 (21%)
5C_CHO_kinase 6..540 CDD:273552 115/557 (21%)
CG1271NP_647763.1 GlpK 32..555 CDD:223628 115/557 (21%)
FGGY_GK5_metazoa 32..552 CDD:212665 115/557 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443086
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.