DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11594 and Rpt6

DIOPT Version :9

Sequence 1:NP_001261391.1 Gene:CG11594 / 38473 FlyBaseID:FBgn0035484 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_608447.1 Gene:Rpt6 / 33105 FlyBaseID:FBgn0020369 Length:405 Species:Drosophila melanogaster


Alignment Length:218 Identity:45/218 - (20%)
Similarity:72/218 - (33%) Gaps:79/218 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RVLEQAVQTIQTWNPEPGYYNQSSDNIWQSICQVVKKVIGGVDKSKVKGIGFDATCSLVVLGPQG 91
            |:|.:.:|.:|    |.|.|              |.:|:..:||.||          ||.:.|:|
  Fly    56 RMLREELQLLQ----EQGSY--------------VGEVVKPMDKKKV----------LVKVHPEG 92

  Fly    92 SPLTVSKSGEAEQNIILWMDHRAEQETQEINAFKHSLLKYVGGQVSLEMEVPKLLWLKRNLSQTF 156
            ..:.     :.::||             :||....:.      :|:|..|...|..:..|.....
  Fly    93 KFVV-----DLDKNI-------------DINDVTPNC------RVALRNESYTLHKILPNKVDPL 133

  Fly   157 GNIWRVFDLPDFLTWRATGVDTRSLCSVVCKWNYDAANGSWNKEFLKQADLEELTQNNFEKLGSD 221
            .::..|..:||.......|:|.:.                  ||..:..:|.......|:.||..
  Fly   134 VSLMMVEKVPDSTYEMVGGLDKQI------------------KEIKEVIELPVKHPELFDALGIA 180

  Fly   222 -------VQPPGRTVGKGLTAKA 237
                   ..|||  .||.|.|:|
  Fly   181 QPKGVLLYGPPG--TGKTLLARA 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11594NP_001261391.1 FGGY_YpCarbK_like 5..540 CDD:212663 45/218 (21%)
5C_CHO_kinase 6..540 CDD:273552 45/218 (21%)
Rpt6NP_608447.1 RPT1 17..403 CDD:224143 45/218 (21%)
SlyX <27..>69 CDD:294687 5/16 (31%)
AAA_16 152..>205 CDD:289934 16/70 (23%)
AAA 185..317 CDD:278434 8/19 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.