DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11594 and Atad2b

DIOPT Version :9

Sequence 1:NP_001261391.1 Gene:CG11594 / 38473 FlyBaseID:FBgn0035484 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_001349278.1 Gene:Atad2b / 320817 MGIID:2444798 Length:1457 Species:Mus musculus


Alignment Length:293 Identity:55/293 - (18%)
Similarity:88/293 - (30%) Gaps:83/293 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 QNNFEKLGSDVQPPGRTVGKGLTAKAAGELGLSAGT--VVSTSLIDAHAGALGMFGCRSKESKGA 274
            :::...|||....||...|.|    |..|.|.:.|:  .:|:....:...|......::..|.||
Mouse     6 KSSLRLLGSKSPGPGPGPGAG----AGAEPGATGGSSHFISSRTRSSKTRAASCPAAKAGGSGGA 66

  Fly   275 DDVQGKMALIAGTSTCHMSITRKACFAQ-----------------GVW----GPYQDAIIPGYFL 318
            .|...|..:....|..|:|...|....|                 ..|    |..:....||..|
Mouse    67 LDEARKAEVDGSLSDSHVSPPAKRTLKQPDSVCKDKSKSRSTGQREEWNIPSGQTRLTSQPGATL 131

  Fly   319 NEGGQSIAGHLLDHVLKSHESYAELKSQLGEDKFIYQHLNKLLPELAAARGLSQVGCLTQDVHVW 383
            ..|..|::       |:||....|.|                        |...:.|:..|:.|.
Mouse   132 PNGHSSLS-------LRSHPLRGEKK------------------------GDGDLSCINGDIEVR 165

  Fly   384 PDLHGNRS------------PIADPTLRGVITGLD---MTRGTESLAIKYLAFVQALAYGTRHII 433
            ......::            .:.:.|...|:..:|   :.|...|      ..|:.|...|....
Mouse   166 KSCRSRKNRFESVNQSLLFDQLVNSTAEAVLQEMDNINIRRNRRS------GEVERLRMWTDTEF 224

  Fly   434 ENLYQYGRAPFQTLLFCGGLAKNPLYVQCHADI 466
            ||:..|.|...:.    ..|.:|...:|.|.::
Mouse   225 ENMDMYSRVKRRR----KSLRRNSYGIQNHHEV 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11594NP_001261391.1 FGGY_YpCarbK_like 5..540 CDD:212663 55/293 (19%)
5C_CHO_kinase 6..540 CDD:273552 55/293 (19%)
Atad2bNP_001349278.1 TIP49 <396..>668 CDD:332389
Bromo_AAA 959..1070 CDD:99957
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.