DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11594 and CG10793

DIOPT Version :9

Sequence 1:NP_001261391.1 Gene:CG11594 / 38473 FlyBaseID:FBgn0035484 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_570054.2 Gene:CG10793 / 31308 FlyBaseID:FBgn0029656 Length:479 Species:Drosophila melanogaster


Alignment Length:396 Identity:81/396 - (20%)
Similarity:132/396 - (33%) Gaps:102/396 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 GVDTRSLCSVVCKWNYDAANGSWNKEFLKQADLEELTQNNFEKLGSDVQPPGRTVGKGLTAKAAG 239
            ||...:...::|:   |..|.|..:..:.......|.:|.:......::..||...:   .:...
  Fly     8 GVTATAAAQILCE---DVRNFSTRRRNILYLMHRYLVENGYYASAESLKSEGRLTDE---YELCD 66

  Fly   240 ELGLSAGTVVSTSLIDAHAG----ALGMFGCRSKESKGADDVQGKMALIAGTSTCHMSITRKACF 300
            .:.|.|..:...|..:...|    .|...|.:.|...|.    ||    |...|....:.:|.  
  Fly    67 NIDLDAMYLEYASFYNMKFGKYPKILKKVGAKIKVEMGG----GK----AHEKTPAKELPKKP-- 121

  Fly   301 AQGVWGPYQDAIIPGYFLNEGGQSIAGHLLDH----VLKSHESYAELKSQ----------LGEDK 351
                  |..||.:..:.:..|.   |...|.:    .:|..|:..|...|          ||.|.
  Fly   122 ------PTTDASLANWHIGVGA---ATQALSNEQPLQIKKMETATESNGQDNACEIEHVHLGGDD 177

  Fly   352 FIYQHLNKLLPELAAARGLSQVGCLTQDVHV-WPDLHGNRSPIADPTLRGVITGLDMTRGTESLA 415
            .::..|     |..:...|.:...|.:::.: |.|:.||:..| :.....|:|.::         
  Fly   178 VLFSSL-----EWQSLAELVKTSILQENIKIKWSDVCGNQRAI-ELIKEAVLTPIE--------- 227

  Fly   416 IKYLAFVQALAYGTRHIIENLYQYGRAPFQTLLFCGG-------LAKNPLYVQCHADIC--NLPA 471
                 |.|..|:|.:            |:::||..|.       ||| .||.:....:.  |:.|
  Fly   228 -----FPQLFAHGLK------------PWRSLLLHGPPGSGKTLLAK-ALYSETQGQVTFFNITA 274

  Fly   472 LI-----PDEQE---MVLVGAAALGAAASGHFDSLESASKSMGGTGQLVKPNAETLEFHNRKYKV 528
            .|     ..|.|   .||...||..|.:...||.:||.:..        :..|...|...|....
  Fly   275 SIMVSKWRGESEKILRVLFHMAAKRAPSVIFFDEIESLTSK--------RDRATDHESSKRFKNE 331

  Fly   529 FLQLLE 534
            .||||:
  Fly   332 LLQLLD 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11594NP_001261391.1 FGGY_YpCarbK_like 5..540 CDD:212663 81/396 (20%)
5C_CHO_kinase 6..540 CDD:273552 81/396 (20%)
CG10793NP_570054.2 LisH 31..56 CDD:285685 2/24 (8%)
P-loop_NTPase 205..>259 CDD:304359 18/81 (22%)
AAA 238..376 CDD:214640 30/109 (28%)
AAA 242..374 CDD:278434 29/105 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.