DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11594 and Katnal2

DIOPT Version :9

Sequence 1:NP_001261391.1 Gene:CG11594 / 38473 FlyBaseID:FBgn0035484 Length:548 Species:Drosophila melanogaster
Sequence 2:XP_006255033.1 Gene:Katnal2 / 307253 RGDID:1564708 Length:537 Species:Rattus norvegicus


Alignment Length:225 Identity:50/225 - (22%)
Similarity:86/225 - (38%) Gaps:54/225 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   324 SIAGHLLDHVLKSHESYAELKSQLGEDKFIYQHLNKLLPELAAARGLSQVGCLTQDVHVWPDLHG 388
            :|.|...::.|.:.|...:...:|.:....:..:|..:.||||.        :::|::    || 
  Rat   195 AIKGATSEYALNTFECNPDPSERLLKPLSAFIGMNSEMRELAAV--------VSRDIY----LH- 246

  Fly   389 NRSPIADPTLR-GVITGLDMTRGTESLAIKYLAFVQALAYGTRHIIENLYQYGRAPFQTLLFCG- 451
                  :|.:: ..|.|||        |.|.|. .:|:.|..|:  ..|:....:|::.||..| 
  Rat   247 ------NPNIKWNDIIGLD--------AAKQLV-KEAVVYPIRY--PQLFTGILSPWKGLLLYGP 294

  Fly   452 -GLAKNPL----YVQCHADICNLPALI------PDEQEM--VLVGAAALGAAASGHFDSLESASK 503
             |..|..|    ..:|.....|:.|..      .|.:::  ||...|...|.::...|.|||...
  Rat   295 PGTGKTLLAKAVATECKTTFFNISASTIVSKWRGDSEKLVRVLFELARYHAPSTIFLDELESVMS 359

  Fly   504 SMGGTGQLVKPNAETLEFHNRKYKVFLQLL 533
            ..|     :.|..|    |....::..:||
  Rat   360 QRG-----MVPGGE----HEGSLRMKTELL 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11594NP_001261391.1 FGGY_YpCarbK_like 5..540 CDD:212663 50/225 (22%)
5C_CHO_kinase 6..540 CDD:273552 50/225 (22%)
Katnal2XP_006255033.1 LisH 25..55 CDD:128913
AAA 285..422 CDD:214640 25/105 (24%)
AAA 289..421 CDD:278434 24/101 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.