DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11594 and Katna1

DIOPT Version :9

Sequence 1:NP_001261391.1 Gene:CG11594 / 38473 FlyBaseID:FBgn0035484 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_001004217.2 Gene:Katna1 / 292464 RGDID:1303062 Length:493 Species:Rattus norvegicus


Alignment Length:291 Identity:64/291 - (21%)
Similarity:106/291 - (36%) Gaps:72/291 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GSARAALVACDGRVLEQAVQTIQTWNPEPGYYNQSSDNIWQSI---CQVVKKVIGGVDKSKVKGI 76
            |:..:|:|...| ||:|..:.:  ::.:..:.:|....:||.|   .:.||:::..::..|:...
  Rat    22 GNYDSAMVYYQG-VLDQINKYL--YSVKDTHLHQKWQQVWQEINVEAKHVKEIMKTLESFKLDST 83

  Fly    77 GFDATCSLVVLGPQGSPLTVSKSGEAEQNIILWM-----------DHRAEQETQEINAFKHSLLK 130
            ...|       .....|   |..||      :|.           ..|..|.||..:...||  .
  Rat    84 SLKA-------AQHELP---SSEGE------VWSLPVPVERRPLPGPRKRQSTQHSDPKPHS--N 130

  Fly   131 YVGGQV--------SLEMEVPKLLWLKRNLSQTFG-----NIWRVFDLPDFLTWRATGVDTRSLC 182
            ..|..|        ||..:..|.:..:....|:.|     .:......|:...:.:||.| :.|.
  Rat   131 RPGAVVRAHRPSAQSLHSDRGKAVRSREKKEQSKGREEKNKLPAAVTEPEANKFDSTGYD-KDLV 194

  Fly   183 SVV----------CKWNYDAANGSWNKEFLKQADLEELTQNNFEKLGSD--------VQPPGRTV 229
            ..:          .:| ||.|:....|:.|::|.:..:....|.| |..        |.|||  .
  Rat   195 EALERDIISQNPNVRW-YDIADLVEAKKLLQEAVVLPMWMPEFFK-GIRRPWKGVLMVGPPG--T 255

  Fly   230 GKGLTAKA-AGELGLSAGTVVSTSLIDAHAG 259
            ||.|.||| |.|...:...|.|::|...:.|
  Rat   256 GKTLLAKAVATECKTTFFNVSSSTLTSKYRG 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11594NP_001261391.1 FGGY_YpCarbK_like 5..540 CDD:212663 64/291 (22%)
5C_CHO_kinase 6..540 CDD:273552 64/291 (22%)
Katna1NP_001004217.2 AAA 243..384 CDD:214640 16/46 (35%)
AAA 247..383 CDD:278434 16/42 (38%)
Vps4_C <458..491 CDD:286426
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.