DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11594 and Katnal1

DIOPT Version :9

Sequence 1:NP_001261391.1 Gene:CG11594 / 38473 FlyBaseID:FBgn0035484 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_001006957.1 Gene:Katnal1 / 288449 RGDID:1359252 Length:488 Species:Rattus norvegicus


Alignment Length:291 Identity:63/291 - (21%)
Similarity:104/291 - (35%) Gaps:86/291 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 WNYDAANGSWNKEFLKQADLEELTQNNFEKLGSD--------VQPPGRTVGKGLTAKA-AGELGL 243
            |: |.|:....|:.|::|.:..:...:|.| |..        |.|||  .||.:.||| |.|.|.
  Rat   205 WD-DIADLEEAKKLLREAVVLPMWMPDFFK-GIRRPWKGVLMVGPPG--TGKTMLAKAVATECGT 265

  Fly   244 SAGTVVSTSLIDAHAGALGMFGCRSKESKGADDVQGKMALIAGTSTCHMSITRKACFAQGVWGPY 308
            :...|.|::|...:.|          ||:....:..:||.....:|..:......|..:|....:
  Rat   266 TFFNVSSSTLTSKYRG----------ESEKLVRLLFEMARFYAPTTIFIDEIDSICSRRGTSDEH 320

  Fly   309 QDAIIPGYFLNEGGQSIAGHLL------------DHVLKSHESYAELKSQLGEDKFIYQHLNK-- 359
                       |..:.:...||            |...|.....|........|:.:.:.|.|  
  Rat   321 -----------EASRRVKSELLIQMDGVGGALENDDPSKMVMVLAATNFPWDIDEALRRRLEKRI 374

  Fly   360 LLPELAAARGLSQVGCLT-QDVHVWPDLHGNRSPIADPT-------------------LRGVITG 404
            .:| |..|:|.:::..:: ::|.:.||:|  ...||:.|                   :|..|.|
  Rat   375 YIP-LPTAKGRAELLKISLREVELDPDIH--LEDIAEKTEGYSGADITNICRDASLMAMRRRING 436

  Fly   405 LD---------------MTRGTESLAIKYLA 420
            |.               :|||...||:|.:|
  Rat   437 LSPEEIRALSKEELQMPVTRGDLELALKKIA 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11594NP_001261391.1 FGGY_YpCarbK_like 5..540 CDD:212663 63/291 (22%)
5C_CHO_kinase 6..540 CDD:273552 63/291 (22%)
Katnal1NP_001006957.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..179
RecA-like_KTNA1 207..376 CDD:410930 40/192 (21%)
AAA_lid_3 400..444 CDD:407720 9/45 (20%)
Vps4_C <448..486 CDD:401324 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.