DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11594 and Psmc5

DIOPT Version :9

Sequence 1:NP_001261391.1 Gene:CG11594 / 38473 FlyBaseID:FBgn0035484 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_032976.1 Gene:Psmc5 / 19184 MGIID:105047 Length:406 Species:Mus musculus


Alignment Length:218 Identity:45/218 - (20%)
Similarity:72/218 - (33%) Gaps:79/218 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RVLEQAVQTIQTWNPEPGYYNQSSDNIWQSICQVVKKVIGGVDKSKVKGIGFDATCSLVVLGPQG 91
            |:|.:.:|.:|    |.|.|              |.:|:..:||.||          ||.:.|:|
Mouse    57 RLLREELQLLQ----EQGSY--------------VGEVVRAMDKKKV----------LVKVHPEG 93

  Fly    92 SPLTVSKSGEAEQNIILWMDHRAEQETQEINAFKHSLLKYVGGQVSLEMEVPKLLWLKRNLSQTF 156
            ..:.     :.::||             :||....:.      :|:|..:...|..:..|.....
Mouse    94 KFVV-----DVDKNI-------------DINDVTPNC------RVALRNDSYTLHKILPNKVDPL 134

  Fly   157 GNIWRVFDLPDFLTWRATGVDTRSLCSVVCKWNYDAANGSWNKEFLKQADLEELTQNNFEKLGSD 221
            .::..|..:||.......|:|.:.                  ||..:..:|.......||.||..
Mouse   135 VSLMMVEKVPDSTYEMIGGLDKQI------------------KEIKEVIELPVKHPELFEALGIA 181

  Fly   222 -------VQPPGRTVGKGLTAKA 237
                   ..|||  .||.|.|:|
Mouse   182 QPKGVLLYGPPG--TGKTLLARA 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11594NP_001261391.1 FGGY_YpCarbK_like 5..540 CDD:212663 45/218 (21%)
5C_CHO_kinase 6..540 CDD:273552 45/218 (21%)
Psmc5NP_032976.1 RPT1 4..404 CDD:224143 45/218 (21%)
May mediate interaction with PRPF9. /evidence=ECO:0000269|PubMed:17349974 186..406 8/19 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.