DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11594 and rpt-2

DIOPT Version :9

Sequence 1:NP_001261391.1 Gene:CG11594 / 38473 FlyBaseID:FBgn0035484 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_504558.1 Gene:rpt-2 / 178988 WormBaseID:WBGene00004502 Length:443 Species:Caenorhabditis elegans


Alignment Length:53 Identity:15/53 - (28%)
Similarity:26/53 - (49%) Gaps:10/53 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 FEKLGSDVQPPGRTV-------GKGLTAKA-AGELGLSAGTVVSTSLIDAHAG 259
            :|::|  ::||...:       ||.|.||| |.:...:...:|.:.||..:.|
 Worm   214 YEEMG--IRPPKGVILYGCPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLG 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11594NP_001261391.1 FGGY_YpCarbK_like 5..540 CDD:212663 15/53 (28%)
5C_CHO_kinase 6..540 CDD:273552 15/53 (28%)
rpt-2NP_504558.1 PTZ00361 1..443 CDD:185575 15/53 (28%)
Prot_ATP_ID_OB 112..>179 CDD:293059
AAA 225..358 CDD:278434 11/40 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.