DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11594 and KATNA1

DIOPT Version :9

Sequence 1:NP_001261391.1 Gene:CG11594 / 38473 FlyBaseID:FBgn0035484 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_008975.1 Gene:KATNA1 / 11104 HGNCID:6216 Length:491 Species:Homo sapiens


Alignment Length:295 Identity:62/295 - (21%)
Similarity:112/295 - (37%) Gaps:80/295 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GSARAALVACDGRVLEQAVQTIQTWNPEPGYYNQSSDNIWQSI---CQVVKKVIGGVDKSKVKGI 76
            |:..:|:|...| ||:|..:.:  ::.:..|..|....:||.|   .:.||.::..::..|:   
Human    20 GNYDSAMVYYQG-VLDQMNKYL--YSVKDTYLQQKWQQVWQEINVEAKHVKDIMKTLESFKL--- 78

  Fly    77 GFDATCSLVVLGPQGSPLTVSK----SGEAEQNIILW-----MDHRAEQETQEINAFKHSLLKYV 132
              |:|           ||..::    :.|.|    :|     ::.|.....::..:.::|..|..
Human    79 --DST-----------PLKAAQHDLPASEGE----VWSMPVPVERRPSPGPRKRQSSQYSDPKSH 126

  Fly   133 GGQVSLEMEVPKLLWLKRNLSQTFGNIWRVFDL-------------------PDFLTWRATGVDT 178
            |.:.|..:.|.:.  ..:|:....|...|..:.                   |:...:.:||.| 
Human   127 GNRPSTTVRVHRS--SAQNVHNDRGKAVRCREKKEQNKGREEKNKSPAAVTEPETNKFDSTGYD- 188

  Fly   179 RSLCSVV----------CKWNYDAANGSWNKEFLKQADLEELTQNNFEKLGSD--------VQPP 225
            :.|...:          .:|: |.|:....|:.||:|.:..:....|.| |..        |.||
Human   189 KDLVEALERDIISQNPNVRWD-DIADLVEAKKLLKEAVVLPMWMPEFFK-GIRRPWKGVLMVGPP 251

  Fly   226 GRTVGKGLTAKA-AGELGLSAGTVVSTSLIDAHAG 259
            |  .||.|.||| |.|...:...|.|::|...:.|
Human   252 G--TGKTLLAKAVATECKTTFFNVSSSTLTSKYRG 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11594NP_001261391.1 FGGY_YpCarbK_like 5..540 CDD:212663 62/295 (21%)
5C_CHO_kinase 6..540 CDD:273552 62/295 (21%)
KATNA1NP_008975.1 Interaction with microtubules 1..185 32/189 (17%)
Interaction with dynein and NDEL1. /evidence=ECO:0000250 1..75 14/57 (25%)
Interaction with KATNB1. /evidence=ECO:0000269|PubMed:10751153 1..29 3/8 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 87..185 13/103 (13%)
AAA 241..382 CDD:214640 16/46 (35%)
AAA 245..381 CDD:278434 16/42 (38%)
Vps4_C <456..489 CDD:286426
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.