DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11594 and atad2b

DIOPT Version :9

Sequence 1:NP_001261391.1 Gene:CG11594 / 38473 FlyBaseID:FBgn0035484 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_001352895.1 Gene:atad2b / 100331225 ZFINID:ZDB-GENE-110411-210 Length:1402 Species:Danio rerio


Alignment Length:174 Identity:35/174 - (20%)
Similarity:65/174 - (37%) Gaps:32/174 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 ATCSLVVLGPQGSPLTVSKSGEAEQNIILWMDHRAEQETQEINAFKHSLLKYVGGQVSLEMEVPK 144
            :.|:|.||.....|.....|.|.::.    ::.:.|...:|:..|...:.|             :
Zfish   923 SACALEVLTLSEDPGPRQLSAEEQRR----LEEQEENTLRELRLFLRDVTK-------------R 970

  Fly   145 LLWLKRNLSQTFGNIWRVFDLPDFLTWRATGVDTRSLCSVVCKWNYDAANGSWNKEFLKQADLEE 209
            |...||  .|.|.....:.::.|:|......:|..::...:.|..|..|     |:||  ||::.
Zfish   971 LATDKR--FQIFSKPVDIEEVSDYLEVITQPMDLSAIMMKIDKHKYMVA-----KDFL--ADIDL 1026

  Fly   210 LTQNNFEKLGSDVQPPGRTVGKGLTAKAAGELGLSAGTVVSTSL 253
            :..|..|      ..|.:..|..:....|..|..:|..::::.|
Zfish  1027 ICSNALE------YNPDKDPGDKIIRHRACSLKDTAHAMIASEL 1064

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11594NP_001261391.1 FGGY_YpCarbK_like 5..540 CDD:212663 35/174 (20%)
5C_CHO_kinase 6..540 CDD:273552 35/174 (20%)
atad2bNP_001352895.1 SpoVK <341..657 CDD:223540
P-loop_NTPase 767..879 CDD:328724
Bromo_AAA 957..1068 CDD:99957 27/136 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.