DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mul1 and DAL1

DIOPT Version :9

Sequence 1:NP_001303365.1 Gene:Mul1 / 38472 FlyBaseID:FBgn0035483 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_176574.2 Gene:DAL1 / 842693 AraportID:AT1G63900 Length:343 Species:Arabidopsis thaliana


Alignment Length:323 Identity:84/323 - (26%)
Similarity:145/323 - (44%) Gaps:35/323 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RTAKVLKAAPQYNIDGDLKSVVERQRDKKI-PYAV-IRGTV---TPIGVPLRSSLVPSVSGVLQI 88
            |.|:||:...:.|...:|..::|  .|.|| |:.| :.|.|   |||     ......:.||:..
plant    25 RDAEVLETVTRVNQLKELAQLLE--LDSKILPFIVAVSGRVGSETPI-----KCEHSGIRGVIVE 82

  Fly    89 VKLHEHRVTRGFAGFWTEQHKLLHESANEMPFELRNQSHGVEIVDALSAAVLDVDVVYDNYEPSN 153
            ....:|.:.....|.|.:...|:...:.|:|:.|.:.:..|.::.|..|....:.|..:.:|.|.
plant    83 ETAEQHFLKHNETGSWVQDSALMLSMSKEVPWFLDDGTSRVHVMGARGATGFALTVGSEVFEESG 147

  Fly   154 LSLFDHVFGFFSGVRQRGLQTTEEVLREGSFLTAIGELELD--GDTLRMQPSNEGPLFLTTATKS 216
            .||......:..|::..|::..|.||..|..||.:||...|  |: .|:|..:.||.::::.:..
plant   148 RSLVRGTLDYLQGLKMLGVKRIERVLPTGIPLTIVGEAVKDDIGE-FRIQKPDRGPFYVSSKSLD 211

  Fly   217 TLIKRFEDAKTTTILKLVVCSTISAILVAFIAKK------LYRKRKQEREE-----AKIRERLDT 270
            .||...  .|.:.:.|  ..|....:|..|:..|      |.|:|:::.::     |..|..|::
plant   212 QLISNL--GKWSRLYK--YASMGFTVLGVFLITKHVIDSVLERRRRRQLQKRVLDAAAKRAELES 272

  Fly   271 E----RRERRARSRPHTLSQDQLCVVCSTNPKEIILLPCGHVCLCEDCAQKISVTCPVCRGSI 329
            |    .||..:.|.....:...|||:|.......:.:||||:|.|..|:..:: :||:||..|
plant   273 EGSNGTRESISDSTKKEDAVPDLCVICLEQEYNAVFVPCGHMCCCTACSSHLT-SCPLCRRRI 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mul1NP_001303365.1 GIDE 89..243 CDD:315205 36/155 (23%)
zf-C3HC4_3 286..329 CDD:316442 15/42 (36%)
modified RING-HC finger (C3HC5-type) 290..325 CDD:319701 12/34 (35%)
DAL1NP_176574.2 GIDE 86..235 CDD:403620 36/153 (24%)
RING-HC_LRSAM1 295..334 CDD:319429 15/39 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 50 1.000 Domainoid score I4386
eggNOG 1 0.900 - - E1_KOG1571
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I2318
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D926101at2759
OrthoFinder 1 1.000 - - FOG0003714
OrthoInspector 1 1.000 - - otm2414
orthoMCL 1 0.900 - - OOG6_105337
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4137
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.770

Return to query results.
Submit another query.