DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mul1 and SPL2

DIOPT Version :9

Sequence 1:NP_001303365.1 Gene:Mul1 / 38472 FlyBaseID:FBgn0035483 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_564653.1 Gene:SPL2 / 841855 AraportID:AT1G54150 Length:383 Species:Arabidopsis thaliana


Alignment Length:381 Identity:85/381 - (22%)
Similarity:146/381 - (38%) Gaps:76/381 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VALGVDLLILGL--------CAREYVHYKRTAKVLKAAPQYNIDGDLKSVVERQRDKKIP----- 59
            :||..|..||||        .|.:|.......|.:|.||:.:| .||:|::....||...     
plant    15 IALSFDGAILGLTLAVSAVGSALKYASTNAALKKIKDAPEVSI-SDLRSLLPASEDKSETNDNRK 78

  Fly    60 -----YAVIRGTVTP-----IGVPLRSSLV-PSVSGVLQIVKLHEHRVTRGFAGFWTEQHKLLHE 113
                 ..|:||.|.|     .|....:.|: |.......|::..:..|..|    |   .:|...
plant    79 SNDQRIVVVRGVVKPKISGDEGYKNNNVLISPETGDKALIIQRTQTYVYSG----W---KRLFQS 136

  Fly   114 SANEMPFELRNQSHGVEIVDALSAAVLDVD----------------------VVYDNYEPSNLSL 156
            :.:....|...:.||.:....:...::..|                      .||:..:|.|.|.
plant   137 TGHRFMLERSLRKHGADFTRTVPFVIVGKDQQSNSSFVAVNMDGSRQPLPLTTVYNRLQPINSSF 201

  Fly   157 FDHVFGFFSGVRQRGLQTTEEVLREGSFLTAIGELELDGDTLRMQPSNEGPLFLTTATKSTLIKR 221
            ..   .|.......||...|::|..|..:||:|....:.....::...:.|.||:..||..:|:.
plant   202 LQ---AFLYPDYPVGLLDIEKILPPGKDITAVGIYSFNNGVPEIKSCQDLPYFLSEMTKDKMIED 263

  Fly   222 FEDAKTTTILKLVVCSTISAILVAFIAKKLYRKRKQEREEAKIRER-----LDTERRERRARSRP 281
            ..:......|..|:...:|..::::.|.:.:.|.||...:.::.:|     :|.|..:      .
plant   264 LMEQTNFIFLGSVILGIVSVGILSYAAVRTWNKWKQWNHQRELPQRPNDSVVDDEPED------A 322

  Fly   282 HTLSQDQLCVVCSTNPKEIILLPCGHVCLCEDCA----QKISVTCPVC----RGSI 329
            ..:...:|||:|.:..:....:|||||..|..||    ::::..||||    |||:
plant   323 DEIPDGELCVICVSRRRVPAFIPCGHVVCCRRCASTVERELNPKCPVCLQSIRGSM 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mul1NP_001303365.1 GIDE 89..243 CDD:315205 31/175 (18%)
zf-C3HC4_3 286..329 CDD:316442 18/50 (36%)
modified RING-HC finger (C3HC5-type) 290..325 CDD:319701 13/38 (34%)
SPL2NP_564653.1 GIDE 140..286 CDD:403620 27/148 (18%)
zf-C3HC4_3 327..377 CDD:404755 17/49 (35%)
RING-HC finger (C3HC4-type) 331..370 CDD:319361 13/38 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1571
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D926101at2759
OrthoFinder 1 1.000 - - FOG0003714
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105337
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.