DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mul1 and SBP1

DIOPT Version :9

Sequence 1:NP_001303365.1 Gene:Mul1 / 38472 FlyBaseID:FBgn0035483 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_175141.1 Gene:SBP1 / 841106 AraportID:AT1G45976 Length:325 Species:Arabidopsis thaliana


Alignment Length:272 Identity:54/272 - (19%)
Similarity:92/272 - (33%) Gaps:101/272 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 VVYDNYEPSNLSLFDHVFGFFSGVRQRGLQTTEEVLREGSFL------------------TAIGE 190
            |..|..:..|.:.|:..:|.       ||:...|.::|..||                  |.:| 
plant    59 VQIDGSDGGNGADFEWNYGL-------GLEPRRERIKEQDFLENNSQISSIDFLQARSVSTGLG- 115

  Fly   191 LELDGDTLRMQPSNEGPLFLTTATKSTLIKRFEDAKTTTILKLVVCSTISAIL----------VA 245
              |..|..|:..|:...|............:.:||.....||:.......|||          |:
plant   116 --LSLDNARVASSDGSALLSLVGDDIDRELQRQDADIDRFLKIQGDQLRHAILDKIKRGQQKTVS 178

  Fly   246 FIAKKLYRKRKQEREEAKIRERLDTERRE---------------------------------RRA 277
            .:.:|:.:|.:::.||.   ||::.:.:|                                 .||
plant   179 LMEEKVVQKLREKDEEL---ERINRKNKELEVRMEQLTMEAEAWQQRAKYNENMIAALNYNLDRA 240

  Fly   278 RSRP--------------------------HTLSQDQLCVVCSTNPKEIILLPCGHVCLCEDCAQ 316
            :.||                          :......:|..|......::||||.|:|||::|.:
plant   241 QGRPRDSIEGCGDSEVDDTASCFNGRDNSNNNTKTMMMCRFCGVREMCMLLLPCNHMCLCKECER 305

  Fly   317 KISVTCPVCRGS 328
            |:| :||:|:.|
plant   306 KLS-SCPLCQSS 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mul1NP_001303365.1 GIDE 89..243 CDD:315205 23/116 (20%)
zf-C3HC4_3 286..329 CDD:316442 17/43 (40%)
modified RING-HC finger (C3HC5-type) 290..325 CDD:319701 15/34 (44%)
SBP1NP_175141.1 bZIP <186..219 CDD:389750 6/35 (17%)
zf-C3HC4_3 277..315 CDD:372816 16/38 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.