DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mul1 and AT1G14688

DIOPT Version :9

Sequence 1:NP_001303365.1 Gene:Mul1 / 38472 FlyBaseID:FBgn0035483 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001117290.1 Gene:AT1G14688 / 6241058 AraportID:AT1G14688 Length:170 Species:Arabidopsis thaliana


Alignment Length:70 Identity:18/70 - (25%)
Similarity:35/70 - (50%) Gaps:2/70 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 EVLREGSFLTAIGELELD-GDTLRMQPSNEGPLFLTTATKSTLIKRFEDAKTTTILKLVVCSTIS 240
            :.|:.|:.||.:||...| ...|.:|.|.|..| :..:.:|:..:...:.|:.:.|.:::.....
plant    58 QALKVGTSLTFVGEAVRDKAGNLMIQKSKEQSL-IVFSEESSFDEMVNNMKSQSELCVILAKIFG 121

  Fly   241 AILVA 245
            :|.||
plant   122 SIAVA 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mul1NP_001303365.1 GIDE 89..243 CDD:315205 15/66 (23%)
zf-C3HC4_3 286..329 CDD:316442
modified RING-HC finger (C3HC5-type) 290..325 CDD:319701
AT1G14688NP_001117290.1 GIDE <60..126 CDD:289266 16/66 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D926101at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.