powered by:
Protein Alignment Mul1 and AT1G14688
DIOPT Version :9
Sequence 1: | NP_001303365.1 |
Gene: | Mul1 / 38472 |
FlyBaseID: | FBgn0035483 |
Length: | 338 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001117290.1 |
Gene: | AT1G14688 / 6241058 |
AraportID: | AT1G14688 |
Length: | 170 |
Species: | Arabidopsis thaliana |
Alignment Length: | 70 |
Identity: | 18/70 - (25%) |
Similarity: | 35/70 - (50%) |
Gaps: | 2/70 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 177 EVLREGSFLTAIGELELD-GDTLRMQPSNEGPLFLTTATKSTLIKRFEDAKTTTILKLVVCSTIS 240
:.|:.|:.||.:||...| ...|.:|.|.|..| :..:.:|:..:...:.|:.:.|.:::.....
plant 58 QALKVGTSLTFVGEAVRDKAGNLMIQKSKEQSL-IVFSEESSFDEMVNNMKSQSELCVILAKIFG 121
Fly 241 AILVA 245
:|.||
plant 122 SIAVA 126
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D926101at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.