DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mul1 and LOC402879

DIOPT Version :9

Sequence 1:NP_001303365.1 Gene:Mul1 / 38472 FlyBaseID:FBgn0035483 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_005171182.1 Gene:LOC402879 / 402879 -ID:- Length:270 Species:Danio rerio


Alignment Length:242 Identity:65/242 - (26%)
Similarity:110/242 - (45%) Gaps:15/242 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GLCAREYVHYKRTAKVLKAAPQYNIDGDLKSVVERQRDKKIPYAVIRGTVTPIGVPLRSSLVPSV 82
            ||..:.|...:...:.||..|.:..|..|..::....:|::.|..:.|.|..:|.|:.|..||..
Zfish    22 GLFYKLYSDKRLEVQKLKEIPNFQPDHHLLRILNASSNKRLHYVAVEGLVQAVGEPISSQYVPRC 86

  Fly    83 SGVLQIVKLHEH-RVTRGFAGFWTEQHKLLHESANEMPFELRNQSH-----GVEIVDALSAAVLD 141
            .||:|.:.:||| :........|..:.....::.|.:||.|.....     .|.:...|.|:...
Zfish    87 HGVIQKITVHEHWKYWNSLLKSWVSKKVNKQQTTNTVPFTLVQPGSFISDVCVRVDSPLEASGDF 151

  Fly   142 VDVVYDNYEPSNLSLFDHVFGFFSGVRQRGLQTTEEVLREGSFLTAIGELELDGD-TLRMQPSNE 205
            :..|:.....:...|.|.|.|..||.:...|:..|::||.|..|||.|||.|:.: .:|:||..:
Zfish   152 LQQVHRRVRNAKEGLMDAVLGEISGEKPIALEEREDLLRVGVPLTAFGELVLEQEKIMRIQPPKD 216

  Fly   206 GPLF-LTTATKSTLIKRFEDA----KTTTILKLVVCSTISAILVAFI 247
            |..| |..:..::.::|.:::    |..|:|..:..||   :|..||
Zfish   217 GRSFVLIPSDYNSFMQRHQNSVNMWKGLTVLFGLTGST---LLAGFI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mul1NP_001303365.1 GIDE 89..243 CDD:315205 42/165 (25%)
zf-C3HC4_3 286..329 CDD:316442
modified RING-HC finger (C3HC5-type) 290..325 CDD:319701
LOC402879XP_005171182.1 GIDE 96..>222 CDD:289266 35/125 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I11451
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D582825at33208
OrthoFinder 1 1.000 - - FOG0003714
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12183
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.