DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mul1 and exc-14

DIOPT Version :9

Sequence 1:NP_001303365.1 Gene:Mul1 / 38472 FlyBaseID:FBgn0035483 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_504354.1 Gene:exc-14 / 178892 WormBaseID:WBGene00019649 Length:400 Species:Caenorhabditis elegans


Alignment Length:318 Identity:75/318 - (23%)
Similarity:123/318 - (38%) Gaps:71/318 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 ERQRDKK---IPYAVIRGTVTPIGVPLRSSLVPSVSGVLQIVKLHEHRVTRGFAGFWTEQHKLLH 112
            |::||:|   ..:.:::..:.    .|.:.....:|.|.::.:|.|.          :||.  |.
 Worm   123 EKERDRKEVDSQFTILKNRIN----HLENEKEQCLSEVQELKRLLED----------SEQD--LK 171

  Fly   113 ESANEMPFELRNQSHGVEIVDALSAAVL----DVDVVYDNYEPSNLSLFDHVFGFFSGVRQRGLQ 173
            :..:||.   |.....||..|||....:    ....::|..|     |.:|....:|..:.|   
 Worm   172 DCKDEMN---RLMEERVETADALDKLTIQNYRQQQEIHDQKE-----LSEHRKKIYSEEKAR--- 225

  Fly   174 TTEEVLREGSFLTAIG-ELELDGDTLRMQPSNEGPLFLTTATKSTLIKRFE-------DAKTTTI 230
            ..||:|......|.:. |||...:.|..|         |..||....|.::       |..|...
 Worm   226 KDEEILNLQKQKTDVEMELERKSNLLDEQ---------TNVTKRMEEKSYQLKPLVLLDELTKKH 281

  Fly   231 LKLVVCST-----ISAILVAFIAKKLYRKRKQEREEAKIRE-RLDTERR------ERRARSRPHT 283
            .:||..||     |:|:.:.:  |:|:....|  .|..:.| :|..|||      :.|:|:|...
 Worm   282 SQLVDLSTEFLPNINAVKMLY--KELFESFPQ--LETNVHESKLSMERRVEEVEEQLRSRNRDFQ 342

  Fly   284 LSQDQL---CVVCSTNPKEIILLPCGHVCLCEDCAQKISV-TCPVCRGSIVSKAAAFI 337
            ..|::|   |.:|......|:.:||.|:..|..|...... .||.||.:|.:....|:
 Worm   343 RLQEKLVAECCICLATKPSIVFMPCRHLITCSGCYDASDFRECPTCRSTIENSITVFM 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mul1NP_001303365.1 GIDE 89..243 CDD:315205 40/170 (24%)
zf-C3HC4_3 286..329 CDD:316442 14/46 (30%)
modified RING-HC finger (C3HC5-type) 290..325 CDD:319701 10/35 (29%)
exc-14NP_504354.1 Smc <112..>272 CDD:224117 39/184 (21%)
zf-C3HC4_3 351..393 CDD:372816 12/41 (29%)
RING-HC finger (C3HC4-type) 352..388 CDD:319361 10/35 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166616
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12183
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.