DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mul1 and mul1a

DIOPT Version :9

Sequence 1:NP_001303365.1 Gene:Mul1 / 38472 FlyBaseID:FBgn0035483 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_031758387.1 Gene:mul1a / 100490540 XenbaseID:XB-GENE-5839754 Length:221 Species:Xenopus tropicalis


Alignment Length:201 Identity:60/201 - (29%)
Similarity:100/201 - (49%) Gaps:25/201 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VDLLILG-LCAREYVHY------KRTAKVLKAAPQYNIDGDLKSVVERQRDKKIPYAVIRGTVTP 69
            ||.|.:| .||...:.|      :...:.:::|.:...|.|||.::|...::::.|.|:.|.|..
 Frog     8 VDTLCVGSSCALTSLFYYLYRCQRAAVRRIQSAQRLQFDSDLKKLLEHSENRELGYVVLEGKVQA 72

  Fly    70 IGVPLRSSLVPSVSGVLQIVKLHEHR-----VTRGFAGFWTEQHKLLHESANEMPFE---LRNQS 126
            :...|:|...|.:..|:|..::.|||     :||.    |:|..:::||..:.:||:   |....
 Frog    73 VNEALKSHFKPHLQAVIQRYQVTEHRLLWNSLTRS----WSESKQVIHEQVDAIPFQLSPLEGSG 133

  Fly   127 HGVEIVDALSAAVLDVDVVYDNY---EPSNLSLFDHVFGFFSGVRQRGLQTTEEVLREGSFLTAI 188
            ..|.|...|:|..|.::.|::.:   .|....:|.|   :.||.:..||..|||:|..|:.||.|
 Frog   134 DSVLISKPLNATGLCLETVHEEFHIPSPGFGEVFRH---YLSGEKPTGLLETEEILPVGAVLTGI 195

  Fly   189 GELELD 194
            |.||||
 Frog   196 GRLELD 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mul1NP_001303365.1 GIDE 89..243 CDD:315205 38/117 (32%)
zf-C3HC4_3 286..329 CDD:316442
modified RING-HC finger (C3HC5-type) 290..325 CDD:319701
mul1aXP_031758387.1 GIDE 92..>210 CDD:403620 38/117 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D582825at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.