Sequence 1: | NP_001303365.1 | Gene: | Mul1 / 38472 | FlyBaseID: | FBgn0035483 | Length: | 338 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_031758387.1 | Gene: | mul1a / 100490540 | XenbaseID: | XB-GENE-5839754 | Length: | 221 | Species: | Xenopus tropicalis |
Alignment Length: | 201 | Identity: | 60/201 - (29%) |
---|---|---|---|
Similarity: | 100/201 - (49%) | Gaps: | 25/201 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 VDLLILG-LCAREYVHY------KRTAKVLKAAPQYNIDGDLKSVVERQRDKKIPYAVIRGTVTP 69
Fly 70 IGVPLRSSLVPSVSGVLQIVKLHEHR-----VTRGFAGFWTEQHKLLHESANEMPFE---LRNQS 126
Fly 127 HGVEIVDALSAAVLDVDVVYDNY---EPSNLSLFDHVFGFFSGVRQRGLQTTEEVLREGSFLTAI 188
Fly 189 GELELD 194 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Mul1 | NP_001303365.1 | GIDE | 89..243 | CDD:315205 | 38/117 (32%) |
zf-C3HC4_3 | 286..329 | CDD:316442 | |||
modified RING-HC finger (C3HC5-type) | 290..325 | CDD:319701 | |||
mul1a | XP_031758387.1 | GIDE | 92..>210 | CDD:403620 | 38/117 (32%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D582825at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |