DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and FHL1

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_015429.1 Gene:FHL1 / 856219 SGDID:S000006308 Length:936 Species:Saccharomyces cerevisiae


Alignment Length:339 Identity:73/339 - (21%)
Similarity:118/339 - (34%) Gaps:107/339 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 KPPFSYIALIAMAISSAPNQR-LTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCFVKIPR 154
            ||..||.|::...|......: ::||.||..|.:.||||:....|||:|:|||||||..|.|:.:
Yeast   461 KPTVSYSAMLTTCIRKYSTAKGMSLSEIYAGIRELFPYYKYCPDGWQSSVRHNLSLNKSFRKVSK 525

  Fly   155 DKNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTRRQRHCG---------------HPNRYE 204
            :          |||..|.||.      |....|.|:.::|....               |..:..
Yeast   526 E----------GKGWLWGLDE------EYIAERERQKKKQSEIAVAKAQAAQLKLEQQQHKLQQV 574

  Fly   205 RESGKD--------------------------SNDGNSSAAEIRSPSEPLSDFDIFCNERPNYSD 243
            .:.||.                          ||..|:::...|:.........|...:|...|.
Yeast   575 PQRGKKDIVSQRSNVNARKQNISQTLAANRAASNRKNTASDNQRTMKYLQEQLVILTRDRKGLSK 639

  Fly   244 RI---------------------------------TDLHRQYLSVSL--GFNSLFNNEARGLRPL 273
            ::                                 .|.:.|:|::.|  ..|:......:|    
Yeast   640 QVIAAILTQALAMTINQVTQAAKNKGITGNPLTALMDKNPQHLNLILAAAVNAATAKVTKG---- 700

  Fly   274 PEIREC--PDDVDASSSSSKAMQSSMELHEELHSPSAFTPPLNRRETSSSGAPVLAEAFNGIKDV 336
             |:::.  |:...|::.::||..|     :.:..|...||.:..|..|...|...:...|.:.| 
Yeast   701 -EVKQLVNPETTAAAALAAKAQHS-----KPIRQPIVQTPHVPDRPPSQLSASASSHPNNYLHD- 758

  Fly   337 VDAPGSSPVASSNR 350
             ..|||...:|.:|
Yeast   759 -KQPGSFDPSSLSR 771

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 35/94 (37%)
FHL1NP_015429.1 COG5025 18..739 CDD:227358 63/303 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.