DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and HCM1

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_009991.2 Gene:HCM1 / 850429 SGDID:S000000661 Length:564 Species:Saccharomyces cerevisiae


Alignment Length:300 Identity:76/300 - (25%)
Similarity:123/300 - (41%) Gaps:83/300 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 NSHRPEKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCF 149
            |....:|||:||..||.:||..:...:||||.||.:|...||||::....|||||||||||||.|
Yeast   103 NGELAKKPPYSYATLICLAILQSQEGKLTLSQIYHWIHVHFPYYKQKDASWQNSIRHNLSLNDAF 167

  Fly   150 VKIPRDKNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTRRQRHCGHPNRYE------RESG 208
            :|        .:....|||.:|.:...|...|.:|..|              .||      ::.|
Yeast   168 IK--------TEKSCDGKGHFWEVRPGAETKFFKGENR--------------GYEFVKDSLQDIG 210

  Fly   209 K--------------DSNDGNSSA--AEIRSPSEPLSDFDIFCNERPNYSDRITDLHRQYLSVSL 257
            |              :|.:||...  .|.|..:......:|..|..|..  |::.||.       
Yeast   211 KYFEIDSTLDELEQVESGEGNDDLPDEEEREEAGKFPSIEIQLNSSPIL--RVSQLHH------- 266

  Fly   258 GFNSLFNNEARGLRPLPEIRECPDDVDASSSSSKAMQSSMELHEELHSPSAFTPP-LNRRETSSS 321
                           :|::: ..:.|.....:.::|::.:|  .::::..:..|| :.::..:|.
Yeast   267 ---------------IPQLK-TDNSVLNPHENLESMRNMIE--NDVNNIDSLEPPYVMKKYHTSL 313

  Fly   322 GAPVLAEAFN----GIKDVVDAPGSSPVASSNRSKTTLFT 357
            |.|.|..|.:    |:|       ::.:..:||..|...|
Yeast   314 GLPSLVNAKDHFQAGVK-------NNNITQANRFNTLPIT 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 41/93 (44%)
HCM1NP_009991.2 COG5025 20..564 CDD:227358 75/299 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46522
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.