DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and AT3G07260

DIOPT Version :10

Sequence 1:NP_523912.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_187382.1 Gene:AT3G07260 / 819914 AraportID:AT3G07260 Length:251 Species:Arabidopsis thaliana


Alignment Length:64 Identity:15/64 - (23%)
Similarity:22/64 - (34%) Gaps:25/64 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 DKNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTRRQRHCGHPNRYERESGKDSNDGNSSA 218
            |::..|:.|..|.|                    ::|.|.   ||...|  .||:...:|.|.|
plant   166 DEDDDEEEDIRGSG--------------------KKTWRD---GHEGVY--ASGEKKREGRSKA 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_523912.1 FH_FOX 89..186 CDD:469596 5/30 (17%)
AT3G07260NP_187382.1 FHA_FKH1-like 14..116 CDD:438753
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.