DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and FHA2

DIOPT Version :10

Sequence 1:NP_523912.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_187378.1 Gene:FHA2 / 819910 AraportID:AT3G07220 Length:320 Species:Arabidopsis thaliana


Alignment Length:57 Identity:17/57 - (29%)
Similarity:22/57 - (38%) Gaps:17/57 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 EDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTRRQRHCGHPNRYERESGKDSNDGNS 216
            ||:|..        |....||...|    ::|||.   ||...|  .||:...:|.|
plant   167 EDDDDD--------DDEEDDMRGSG----KKTRRD---GHEVVY--ASGEKKREGRS 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_523912.1 FH_FOX 89..186 CDD:469596 7/25 (28%)
FHA2NP_187378.1 FHA_FKH1-like 14..116 CDD:438753
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.