DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and foxk2b

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:XP_001922856.1 Gene:foxk2b / 798356 ZFINID:ZDB-GENE-030131-5310 Length:597 Species:Danio rerio


Alignment Length:366 Identity:100/366 - (27%)
Similarity:154/366 - (42%) Gaps:89/366 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LPDNEELVNSMLANPDYLRTQVSPNPLAPSAVGGAGMEGLMCGSFSPAFYYQGIDSFLALHNNIW 76
            :|||...:.|.|.:|   ...:|.....||:..|||..|...|...|                  
Zfish   140 IPDNIAHLMSPLPSP---TGTISAANSCPSSPRGAGSSGYRLGRIVP------------------ 183

  Fly    77 GLPISFLHNSHRPE---------------KPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFP 126
              .:..::::.:.|               |||:||..||..||:.||:::|||:|||..|...:|
Zfish   184 --DLQLMNDNSQSENDKETSEGDSPKDDSKPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYP 246

  Fly   127 YYRENKQGWQNSIRHNLSLNDCFVKIPRDKNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRT 191
            |||...:|||||||||||||..|:|:||.:      :..||||:|.:|.|:.....:..:|:||.
Zfish   247 YYRTADKGWQNSIRHNLSLNRYFIKVPRSQ------EEPGKGSFWRIDPSSEGKLVEQAFRKRRP 305

  Fly   192 RRQRHCGHPNRYERESGKDSNDGNSSAAEIRSPSEPLSDFDIFCNERPNYSDRITDLHRQYLSVS 256
            |     |.|.                   .|:|..|||...  ....||:|. :...|...:...
Zfish   306 R-----GVPC-------------------FRTPLGPLSSRS--APASPNHSG-VLSAHSSGVQTP 343

  Fly   257 LGFNSLFNNEARGLRPLPEIRECPDDVDASSSSSKAMQSSMELHEELHSPSAFTPPLNRRETSSS 321
               :||    :|...|:|...|.......::.:..|:|..:.:.:|    :.||.  |...:..:
Zfish   344 ---DSL----SREGSPVPMESEPVSVPPPAAVAVAAVQPKLAVIQE----TRFTQ--NTTASPIT 395

  Fly   322 GAPVLAEA----FNGIKDVVDAPGSSPVASSNRSKTTLFTI 358
            ..|||...    ...:|.|..|. ::||:||..::..:.|:
Zfish   396 TQPVLIAVQRPLTQNMKPVTYAV-AAPVSSSTSAQPLMQTV 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 46/93 (49%)
foxk2bXP_001922856.1 FHA 17..109 CDD:238017
Forkhead 211..297 CDD:278670 46/91 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.