DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and foxj3

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001313317.1 Gene:foxj3 / 797147 ZFINID:ZDB-GENE-101005-1 Length:596 Species:Danio rerio


Alignment Length:323 Identity:96/323 - (29%)
Similarity:147/323 - (45%) Gaps:82/323 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 HRPEKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCFVK 151
            |:..|||:||.:||..||:|:|.:::|||.||::|.|.||||||...||:||||||||||.||:|
Zfish    58 HKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLK 122

  Fly   152 IPRDKNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTRRQRHCGHPNRYERES-GKDSNDGN 215
            :||.|      |..||||||.:|::..: .......::|.|.......|...|.:: |.|.....
Zfish   123 VPRSK------DDPGKGSYWAIDTNPKE-DTLPTRPKKRPRSGERASTPYSLESDNLGMDCIISG 180

  Fly   216 SSA-----------AEIRSPSEPLSDFDIFCNERPNYSDRITDLHRQYLSVSLGFNSLFN----- 264
            |::           ..:.:|.:..||     :.|.:.::.::|   |.|: |:..||:.:     
Zfish   181 SASPTLAINTVTNKVALYNPDQDGSD-----SPRSSLNNSLSD---QSLA-SVNLNSVGSVHSYT 236

  Fly   265 ---------NEARGLRPLPEIR-ECPD-----------DVDASSSS--------SKAMQSSMELH 300
                     :::..|:..|:.: ..||           |:.||..|        |...||.|.|.
Zfish   237 PVTSHPESVSQSMSLQQAPQAQYSIPDRDKQLLFSEFEDLSASFRSLYKTVFEQSYNQQSLMGLP 301

  Fly   301 EE-----------LHSPSAFTPPLNRRETSSSGAPVLAEAFNGI-KDVVDAPGSSPVASSNRS 351
            .|           .||||:.  |.|.:.:.::..|      |.| .:....|.|.|..|::.|
Zfish   302 SESSQQTHTSCSYQHSPSSH--PHNNQNSITNSHP------NNIPNNGSQVPLSHPPHSAHNS 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 50/93 (54%)
foxj3NP_001313317.1 Forkhead 62..139 CDD:278670 49/82 (60%)
SelP_N <327..394 CDD:282453 8/36 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.