DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxL1 and foxf1

DIOPT Version :9

Sequence 1:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001039226.1 Gene:foxf1 / 734087 XenbaseID:XB-GENE-478922 Length:373 Species:Xenopus tropicalis


Alignment Length:324 Identity:98/324 - (30%)
Similarity:151/324 - (46%) Gaps:77/324 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 RPEKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCFVKI 152
            ||||||:||||||.|||.|:|.:|||||.||:|:..:||::|.:.|||:||:|||||||:||:|:
 Frog    51 RPEKPPYSYIALIVMAIQSSPTKRLTLSEIYQFLQSRFPFFRGSYQGWKNSVRHNLSLNECFIKL 115

  Fly   153 PRDKNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTRRQRHC---------------GH--- 199
            |:...      ..|||.||.:|.::..|||:|::|||....:|.|               .|   
 Frog   116 PKGLG------RPGKGHYWTIDPASEFMFEEGSFRRRPRGFRRKCQALKPMYSMMNGLGFNHIPE 174

  Fly   200 --------------PNRYERESGKDSNDGN--SSAAEIRSPSEPLSDFDIFCNERPNYSDRITD- 247
                          ||....:||....:|:  |:...:.....|:|  .|..|...:|....|. 
 Frog   175 TYSFQGASGTIACPPNSLSLDSGIGMMNGHLPSNVDGMGLSGHPVS--HIAANGGHSYMGSCTGS 237

  Fly   248 -----LHRQYLSVSLGF------NSLFNNEARGLRP---LPEIRECPDDVDASSSSSKAMQSSME 298
                 .|....|..||.      :|::::.|....|   .|.|::.|  :...:|::..:.||:.
 Frog   238 SGGDYSHHDSGSPLLGGGGVMEPHSVYSSPASAWAPSASTPYIKQQP--LSPCNSAANPLSSSLS 300

  Fly   299 --------LHEELHSPSAFTPPLNRRETSSSGAPVLAEAFNGIKDVV---DAPGSSPVASSNRS 351
                    ||:..|:.::....:.|..:.|       .:.|..|:.|   :|..||.:.|.:.|
 Frog   301 SHSLDQSYLHQNSHNTASELQGIPRYHSQS-------PSMNDRKEFVFSFNAMASSSMHSGSGS 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxL1NP_001246609.1 FH 91..185 CDD:214627 50/93 (54%)
foxf1NP_001039226.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51 98/324 (30%)
Forkhead 53..139 CDD:365978 49/91 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 236..255 4/18 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 283..306 4/24 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.